Identifiers and Description

Gene Model Identifier

TTHERM_00086720

Standard Name

HPL1 (Heterochromatin Protein 1 Like 1)

Aliases

PreTt16421 | 6.m00495 | 3836.m02088 | COI6

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00086720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02463.14.000904604388404e-59hypothetical protein (1621 aa)
OxytrichaContig19010.0.g640.000030009396760408108Chromo (CHRromatin Organisatio
n MOdifier) domain

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
HPL1,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00086720(coding)
ATGGCTAAGATAAAATACGAAGGAAGTCAAAAATAGAATGTAAAGAAAAGAACTATGCAT
GTGGTTGATGATGATGAAGACGAAGAGCAACCGGTTTATCCCATAGAAGAAGAATACAAT
GTTGAATATTTATATGGAAAAAAATTTGAAAATGGTTAAATTAAGTATTGTGTAAAATGG
GAAAATTATACTTTTGAAGAAAGTTCATTCGAGCCAGTAGAAAATCTAGAAAATGTTGTC
TACAATATGAGGGGATTTGAAAGAAAAATGAGTGATTTGATATTTAGAGTTGCTTTGCTC
TAAAATGCTAAGAAAAAATTACCTCCATTTTAAGTTAATCCTATTCAATTAATTCAAAAA
GATAACATTGAAAATACTAAGGAATAAATAGAGCCTTCTTAGGCATAAAACCACCTATAA
AAAGAGCCTTCTGTAATTAACAATTAAACTAGTGTAGAGAAATTTCAAAGTGCACCATAA
TAATCACCTAAAAAAATCAATGGTGGAATATCAGATAACCAAATTACGTAGAATTAGTAA
AGCTTAATTGAAACTAATTTAAATTCAAACAATAACTGTTAGATTTAAGGAAGTCCTAAA
TTAGCTGAAAATCTAGAAAAACCTCAAAATGGTAGCTAAAATTTAGCTGAAAAAAATTAC
CTGAAGACAAATGGAAACAGTAATAATTAATTATAGCACAATCACAACAACCAATAACAA
AATAATGGAAATTAATTATTGAATCTTAATTAGAGTTTAAATTTATTGTAAAGTAACGGA
TAGCATTAAAGCTAGTAAAAATAATCATCTAATGGAAATAATTAAAACTCTCAAAACAAA
TAAAGCCTTTCTTATAACTTAAATGGTAATGGATAACATTAAAAGAAGGTTGAAAATTAA
GCAATTGGTTAAGTTAATTCAATTAGTTAAGTTTAAAATAAATAAACTTAACTTTATGAA
AAAAATCGTAGAACAAATTCTTAAGATTAGTATATTTAAACTAAATTAGATCAAAACCTT
AGTTATATATCTTAAAAGCAATTACCAAAGCCTATTGAAGACAATAAAACAATGGAGGTT
GTACAAACAAAAAACAAAAGTCAACTTCAATTTAGAGATCCAGTTCTGGAAAACGAATTA
AACAGCAATGCTTATTCAGCATAAGTAGTTGTAGATGATACTAGCAAATATGGTAATTTC
AACAACGGAGACATTCCTCTTAAAATATTGAAGCATGCTCCTTATACAAGAATTCAGAAA
GTGATAGGAAATAATGTCGATTTACCTAGCAGTCTTTACTTTAAAGTTATATTTAAACCT
AGACCTTCTGGTACAGTTCCTTAACCTGCCTATATTGCATTCAATGAGCTCAAAGATAGA
TACCCAAGAGTTTTAATGGAATACTATGAGTAACATGCAATTTTGTTAGATCCTGTTCCA
GATTAGGCAGAACTCTAGTTGTAAAAGACAAACAGTAGGGATTTAAATGTCAAGAATGAT
GCATCTCTTATTTCAAACGCAGGAAATAATAAGAAGATGGTAAACGGGAAAGAAAATAGA
ATAAATATCTGA


>TTHERM_00086720(protein)
MAKIKYEGSQKQNVKKRTMHVVDDDEDEEQPVYPIEEEYNVEYLYGKKFENGQIKYCVKW
ENYTFEESSFEPVENLENVVYNMRGFERKMSDLIFRVALLQNAKKKLPPFQVNPIQLIQK
DNIENTKEQIEPSQAQNHLQKEPSVINNQTSVEKFQSAPQQSPKKINGGISDNQITQNQQ
SLIETNLNSNNNCQIQGSPKLAENLEKPQNGSQNLAEKNYLKTNGNSNNQLQHNHNNQQQ
NNGNQLLNLNQSLNLLQSNGQHQSQQKQSSNGNNQNSQNKQSLSYNLNGNGQHQKKVENQ
AIGQVNSISQVQNKQTQLYEKNRRTNSQDQYIQTKLDQNLSYISQKQLPKPIEDNKTMEV
VQTKNKSQLQFRDPVLENELNSNAYSAQVVVDDTSKYGNFNNGDIPLKILKHAPYTRIQK
VIGNNVDLPSSLYFKVIFKPRPSGTVPQPAYIAFNELKDRYPRVLMEYYEQHAILLDPVP
DQAELQLQKTNSRDLNVKNDASLISNAGNNKKMVNGKENRINI


>TTHERM_00086720(gene)
ATGGCTAAGATAAAATACGAAGGAAGTCAAAAATAGAATGTAAAGAAAAGAACTATGCAT
GTGGTTGATGATGATGAAGACGAAGAGCAACCGGTTTATCGTAAATTATAGATTTTTGAT
TATTTTTAAATAAATTTTTTTATTTTAATATAGCCATAGAAGAAGAATACAATGTTGAAT
ATTTATATGGAAAAAAATTTGAAAATGGTTAAATTAAGTATTGTGTAAAATGGGAAAATT
ATACTTTTGAAGAAAGTTCATTCGAGCCAGTAGAAAATCTAGAAAATGTTGTCTACAATA
TGAGGGGATTTGAAAGAAAAATGAGTGATTTGATATTTAGAGTTGCTTTGCTCTAAAATG
CTAAGAAAAAATTACCTCCATTTTAAGTTAATCCTATTCAATTAATTCAAAAAGATAACA
TTGAAAATACTAAGGAATAAATAGAGCCTTCTTAGGCATAAAACCACCTATAAAAAGAGC
CTTCTGTAATTAACAATTAAACTAGTGTAGAGAAATTTCAAAGTGCACCATAATAATCAC
CTAAAAAAATCAATGGTGGAATATCAGATAACCAAATTACGTAGAATTAGTAAAGCTTAA
TTGAAACTAATTTAAATTCAAACAATAACTGTTAGATTTAAGGAAGTCCTAAATTAGCTG
AAAATCTAGAAAAACCTCAAAATGGTAGCTAAAATTTAGCTGAAAAAAATTACCTGAAGA
CAAATGGAAACAGTAATAATTAATTATAGCACAATCACAACAACCAATAACAAAATAATG
GAAATTAATTATTGAATCTTAATTAGAGTTTAAATTTATTGTAAAGTAACGGATAGCATT
AAAGCTAGTAAAAATAATCATCTAATGGAAATAATTAAAACTCTCAAAACAAATAAAGCC
TTTCTTATAACTTAAATGGTAATGGATAACATTAAAAGAAGGTTGAAAATTAAGCAATTG
GTTAAGTTAATTCAATTAGTTAAGTTTAAAATAAATAAACTTAACTTTATGAAAAAAATC
GTAGAACAAATTCTTAAGATTAGTATATTTAAACTAAATTAGATCAAAACCTTAGTTATA
TATCTTAAAAGCAATTACCAAAGCCTATTGAAGACAATAAAACAATGGAGGTTGTACAAA
CAAAAAACAAAAGTCAACTTCAATTTAGAGATCCAGTTCTGGAAAACGAATTAAACAGCA
ATGCTTATTCAGCATAAGTAGTTGTAGATGATACTAGCAAATATGGTAATTTCAACAACG
GAGACATTCCTCTTAAAATATTGAAGCATGCTCCTTATACAAGAATTCAGAAAGTGATAG
GAAATAATGTCGATTTACCTAGCAGTCTTTACTTTAAAGTTATATTTAAACCTAGACCTT
CTGGTACAGTTCCTTAACCTGCCTATATTGCATTCAATGAGCTCAAAGATAGATACCCAA
GAGTTTTAATGGAATACTATGAGTAACATGCAATTTTGTTAGATCCTGTTCCAGATTAGG
CAGAACTCTAGTTGTAAAAGACAAACAGTAGGGATTTAAATGTCAAGAATGATGCATCTC
TTATTTCAAACGCAGGAAATAATAAGAAGATGGTAAACGGGAAAGAAAATAGAATAAATA
TCTGA