Identifiers and Description

Gene Model Identifier

TTHERM_00794620

Standard Name

HOP2 (Meiosis-specific homolog of budding yeast HOmologous Pairing 2)

Aliases

PreTt21461 | 134.m00141 | HOP2A

Description

HOP2 has a role in chiasmata and meiotic bivalent formation. There exists a ubiquitously expressed paralog, TTHERM_01190440 (HOPP2), which is essential for vegetative growth.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF07106 ) Tat binding protein 1(TBP-1)-interacting protein
  • ( TIGR02220 ) phage conserved hypothetical protein, C-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00794620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13340.18.002072745601587e-114hypothetical protein (334 aa)
OxytrichaContig9892.0.g550.0000000020002373268528243Tat binding protein 1(TBP-1)-i
nteracting protein (TBPIP)
SGDYGL033W0.0004000184047659232HOP2 Meiosis-specific protein
that localizes to chromosomes,
preventing synapsis between n
onhomologous chromosomes and e
nsuring synapsis between homol
ogs; complexes with Mnd1p to p
romote homolog pairing and mei
otic double-strand break repai
r

General Information

Paragraph NoGene NameParagraph Text
54HOP2Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.

Associated Literature

  1. Ref:18522989: Mochizuki K, Novatchkova M, Loidl J (2008) DNA double-strand breaks, but not crossovers, are required for the reorganization of meiotic nuclei in Tetrahymena. Journal of cell science 121(Pt 13):2148-58

Sequences

>TTHERM_00794620(coding)
ATGAGCGATACTGAAGTAAATACAGAAATCGATTTAGGGACAGTAAAAAAAAGGAAAAAT
GCTAAAAATGTTGATAAATAATAAGATGAGGATGCTAAAAAAAAAGATCAAATGGACACT
GTTAAAATTGGGTAAAATAAAAAGGAAATGCCAAAAAAGAAAAAAAGTTCTTCAAAAGAG
TCTTTGGTTTCCTCTGTTTCTGAATAAAAAAACCAGTAAAAAAAAGCAGCAAAAAATAAT
AATAAAAAAGCATTAAAAAACCTTGACGAAGAAGTAATTGGGGATGAAAATACTGATGAA
AGTGATAGCGATGAACAGATAGCAAAAGAAGATATTTCTACTTGTGACTAAAAACCAAAA
GGCGGAAAGGGTGCAAAGAAAGAGCAAAAAGCTAACAATAAAAATAAATACTCTGTTTAA
GATTACTAAACCTTGATTGATTACATGAAAAACTCTAACAAGCCTTTTAATGCAACTACT
CTTGAAAGTAACTTAAAAGGAAAAACATAATTTAAAAAAGGGTCAATTGAGGCTGCACTT
AGTTAGGCTGTTGAAGAAAAATATATTGTTAGAAAAGCATATGGTAGTGCATATGTATTT
TGGTATAACCAAGAACTTCTTCCTGTTGTAAATAAAGAGGAGATAGAGTAGTTGACTAAT
GAAATTCTAAATAAATAAAAAGAGGCTTCAGAAGTAAACTAAAAATTAAGAAATTTAGTT
TCTTAGTTATCGAAAGTAATGTAAGAAAAAACAAACGATTAGTTGCAACTAGAAATAGAA
AAATTTAAACAGTAAATTTTTTAATTAGATTAAGATATGCAATATTTTACTAGTGAATCG
TTTATACCAGAAGACTCTAACGTTGTAAGATAAATTGAAGATAAGCTAGCTAAAATAGAA
GGTATATTTAAAAAAAGAAAAAGAACTTGTGAAGAAGCCGTCAAGGATTTATTGGAAAAC
CAAGAGGAAAGCATAAGCTTATAATAGATGTTTTAAACAATAGGAATTGATGAAGCAGAT
AATTCAGCTCTTATCTGA


>TTHERM_00794620(protein)
MSDTEVNTEIDLGTVKKRKNAKNVDKQQDEDAKKKDQMDTVKIGQNKKEMPKKKKSSSKE
SLVSSVSEQKNQQKKAAKNNNKKALKNLDEEVIGDENTDESDSDEQIAKEDISTCDQKPK
GGKGAKKEQKANNKNKYSVQDYQTLIDYMKNSNKPFNATTLESNLKGKTQFKKGSIEAAL
SQAVEEKYIVRKAYGSAYVFWYNQELLPVVNKEEIEQLTNEILNKQKEASEVNQKLRNLV
SQLSKVMQEKTNDQLQLEIEKFKQQIFQLDQDMQYFTSESFIPEDSNVVRQIEDKLAKIE
GIFKKRKRTCEEAVKDLLENQEESISLQQMFQTIGIDEADNSALI


>TTHERM_00794620(gene)
ATGAGCGATACTGAAGTAAATACAGAAATCGATTTAGGGACAGTAAAAAAAAGGAAAAAT
GCTAAAAATGTTGATAAATAATAAGATGAGGATGCTAAAAAAAAAGATCAAATGGACACT
GTTAAAATTGGGTAAAATAAAAAGGAAATGCCAAAAAAGAAAAAAAGTTCTTCAAAAGAG
TCTTTGGTTTCCTCTGTTTCTGAATAAAAAAACCAGTAAAAAAAAGCAGCAAAAGTAAGA
TAAAATTTTTCAAATAAATCTAACTAAATTAAAATTATTTTTGATTAAAGAATAATAATA
AAAAAGCATTAAAAAACCTTGACGAAGAAGTAATTGGGGATGAAAATACTGATGAAAGTG
ATAGCGATGAACAGATAGCAAAAGAAGATATTTCTACTTGTGACTAAAAACCAAAAGGCG
GAAAGGTTTTTAGTTAACCATTTATTATTTCTTCAAATTAATAACTCTGAATTTATTTTA
CTTATTTTTGATTGATAAAATCATAAGGGTGCAAAGAAAGAGCAAAAAGCTAACAATAAA
AATAAATACTCTGTTTAAGGTAAAAATACTTGAATGTACTTGAGAACAAATTCTTGATAC
AAATAATGTTATTTTAAAATTAGATTACTAAACCTTGATTGATTACATGAAAAACTCTAA
CAAGCCTTTTAATGCAACTACTCTTGAAAGTAACTTAAAAGGAAAAACATAATTTAAAAA
AGGGTCAATTGAGGCTGCACTTAGTTAGGCTGTTGAAGAAAAATATATTGTTAGAAAAGC
ATATGGTAGTGCATATGTATTTTGGTATAACCAAGAACTTCTTCCTGTTGTAAATAAAGA
GGAGATAGAGTAGTTGACTAATGAAATTCTAAATAAATAAAAAGAGGCTTCAGAAGTAAA
CTAAAAATTAAGAAATTTAGTTTCTTAGTTATCGAAAGTAATGTAAGAAAAAACAAACGA
TTAGTTGCAACTAGAAATAGAAAAATTTAAACAGTAAATTTTTTAATTAGATTAAGATAT
GCAATATTTTACTAGTGAATCGTTTATACCAGAAGACTCTAACGTTGTAAGATAAATTGA
AGATAAGCTAGCTAAAATAGAAGTACTAATTAATTAATCATACCCTTTTTTAATTTCTAA
TTATATTTAAATAGGGTATATTTAAAAAAAGAAAAAGAACTTGTGAAGAAGCCGTCAAGG
ATTTATTGGAAAACCAAGAGGAAAGCATAAGCTTATAATAGATGTTTTAAACAATAGGAA
TTGATGAAGCAGATAATTCAGCTCTTATCTGA