Identifiers and Description

Gene Model Identifier

TTHERM_00971920

Standard Name

HMK1 (Hippo/MST Kinase 1)

Aliases

PreTt01462 | 180.m00082 | 3749.m00280 | CDAI

Description

Hippo/MST kinase; cortical protein found in anterior of cell early in division, later expressed in posterior end of anterior daughter cell; mutants lead to asymmetrical daughter cell sizes

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00971920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20002.19.997093137033517e-262protein kinase domain-containi
ng protein (1284 aa)
OxytrichaContig1275.1.g503.001222955304439e-106Protein kinase domain
DictyBaseDDB_G02841811.999022616705709e-90krsA on chromosome: 4 position
1697612 to 1699450
WormBaseWBGene000160382.0006821221283624e-88locus:cst-2 status:Partially
_confirmed UniProt:Q304D8
protein_id:CCD65397.1
SGDYHR102W9.9952060159684e-60KIC1 Protein kinase of the PAK
/Ste20 family, required for ce
ll integrity; physically inter
acts with Cdc31p (centrin), wh
ich is a component of the spin
dle pole body; part of the RAM
network that regulates cellul
ar polarity and morphogenesis
Stentor CoeruleusSteCoe_52862.506567475899953e-46

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00971920(coding)
ATGAATATGAACGAAATAGGAAGTGATAGTATAATATGTACTACAGAAAATCCTGAGTAG
ATATTCAGTTTAGTAGAAATATTAGGTCAAGGCTCATATGGAAAAGTCTTTAAAGCATTG
AATTTATAAAACAATAAATATTATGCAGTTAAAGTAGTTAATACTGGAAATGGAGATTTT
GATAACTTGAAGAAAGAGATTAGTATTTTATAGGATTGCCAGAGCGATTATATTGTCCAT
TACTATGGTAGTTATTTATATAACGAATAGTTATGGATTATTATGGAATACTGTGATATT
GGTAGTGTTAATGATTTAATGAAGGCAACCTAGAGAACACTTAGTGAAGTTTAGATTGCT
TGCATACTTAAGGGTGTACTCCTTGGATTAAAGTATCTTCATAACTCAAAAAAAATACAC
AGAGATATTAAAGCTGGAAATATCCTCATCAACAAAGATGGTGCATGCAAACTCGCTGAT
TTTGGTGTATCTGCTTAGCTCTTTAATACTATGGGATACATAGAATCTTTCATTGGCACT
CCTTACTGGATGTCACCTGAAGTACTAACTTAAAATAAATACAATAAAAAAACTGATATA
TGGAGCTTAGGGATCACAGCTATAGAGATGGCTGAAGGAAATCCTCCCTTTAGCAATTTC
TAAGCAGTTTCGGCAATGATCTTAATTATTAAAAAGCCTCCACAAGGTTTAAGCGATCCT
ACAAAATGGAGTTAAGAGTTTAATAGATTTGTAAGCAGATGTCTAACTATTAATCCTGAC
ATACGCCCAACTTCAGAAGAACTCCTCCTTGATCCTTTTATTGTCAATAACACAACTAGG
GTTAATCCTTAACATTTTTTAATGAATCTAGTTTCTGATAATATGGAGAGTATTAGAGTT
TTTCGCAAAAATTTACTTGAGAAGTAGAAAGGAGAAACTTAGTAACAAGGGGAAAAGAAA
AACAAGTAACAACCTGCATAGTAACAGCAATAAGAATAGAAAAAAGAAGAGAAAAAATAA
GTTGATAAAAGATTAATGACAGAGGCTTCTCATGATTTTTAGGATTACATTGCTAATGAT
AGCGGTACAGTTATTGAATATTAAAACTATGACCAATTTAATAATGAACCTGATCAGCAC
TAATAATTTTACAAGAAATAAAATTAATTTATCAACAATAATAATGATAAATAAAATAAT
TTTATTTGGGAAAATGAGACAGGAACTATGGTAGAAAAATTAGAAAATGATGATGGTGAA
GATGAAGAATAAAAAGATGACAACTTAAAATAACCAGAAAATTCTGATTTTATGAAACAA
TTTTCTAAAAAAGAAGATGGTTTTTAAAATATCAATTGGGCACAAAATAAGAAAGAAGAT
TCTTCATTTTCAAACAAACCAAATTCAAATTTGTAAAAAAATAATTCGATAGGCAATAAA
TCAGAGCAGAGAGAAATGACTTCTTAATATAATTAAATTGAGCAAGAAGATGACTAAGTT
AATAGCTCTGTTATTATTAAGGAAGACTATGAAATAGAGCACATCAAAAACTAAGCTTAT
TCTGGTGTTGCAGTAACAGACTCAGAAAAAAAAATCTAGTAAAAAAATGTACCAGATTTT
GTTTTATTTGCATAAAAAATGGAAGAAAACAATAACAAGAATTTCCCAAAAAAACCTTTA
AATATAAATATTTAAACAGACAATATCCATATTTAAGTACCTTAATCGTCAACTCCTTAA
CAACAAAAATAATAGACTACTAAGTAATCTATCAGTGAAGATAGTGATATTCCTTCAGAA
TATAAGAACATGAATGAGTAATAAATTGAGACCATGATAGAAACACTTAAAAAAGAGCTA
GAGATGGAGCTAAAAGCTATATAAGATGCTTACTCCTAAAAAATTACGAGATGTGAGAAA
GCTTTGAAATTAGTGAAATCTAAAAAAAATGGATCATTCACTCCTACTTCTCTCCCAATG
TAATTAATATAAATTCCTCAAAATAATAACTTTGTAAACTAAGAACCTATTAGTCCTATA
AAAAGAAATATAAATAATCAGTTATTACCTTAATAGTAGTAATAATATTTACCTTCTCCT
TCATCTACGGCTATGAAAAACAATTTAGAATACCTAGTCTCATCACCACATCTTGCTCCA
AGTGCACTTCCATAAATTAGCTAATCTCCATACATCAAAAACCTTAATTTGGTAAATGGA
GGAGTTTATGATTCAAATAACAATAGTTAAAATTTACTTAATGGTACCAGCTCTAACTAA
ATCCAAAACAAACTTCCGAACAAAGGATTTAATGCTTTATAATCAAGCAATAACCCTATG
TATACAAGCACAAATAATTTAGTAAACCAAAGCAGCAATAATAATCCTTTGACTCATTTA
AATCCTGTTTTAAATAATATTTATTCTGAAATGCCATTACCTGCTACTCCAAAAACAAAA
GAATAAGCTTAATAGAATAATGGAGGATTAAATTATGCTCTCGGAGTACAAACACAGCCA
ACTTCTTCTAACATTTATTTAACTAGTTGTTAAAAATCTAGCAATAATAATAGTAATATT
GCTCAATATACAAATGGATAAATTCCTGTTTAATCTCAATCTAACTAGCAAGAAGATATT
ATTAATAATATTAAAAGATAATTCTAAATCACAAATTCTGTTTTAGGAAATGTTGAAAGC
AGCAATCAATAATAATAGAAGTAAGCTATTATAAATAATGAGATGTAATTAAGGAAAATT
AATAGTAATCATCCAATTAACTAATTAAAAAATTCAAAGAATAATTAGCTTTTCGAAAGC
AATATGCTGAATAAATAACCATCTAAACCAACTAGCCAAAACTCTAATTTCTCAAAAGGC
ATTCAATCTTCTTCTCCAATGATCACTTAAGGAGGAGGTCTTTCATTTGAAGAAGCATTA
AATAGAAAGAACATACTTAAGTAAAACTAAGTATAGAATAGCAGTAACAATAACAATAGT
ACTGTCTATGACGAAAATGCAATATACGCTTAATAGATGCAGTTACAGTAAAAGTAAAGG
CTTTAGTAAGAATAAAACGGAAGCACTAAAGCTTAGTCTTATATTAATATGTCATAAATA
CCAACTGGAACTACTCCAAATAAGTTATCAAATTTAGATTAAATTAATATACTCTAGCAA
AAGTCTGTATAAAATAATAATCGTTAAATTCCATAAACCACATTGTATAATTAAGCAGAA
AGATCTCAAACTGAGTAGTCTCATAACGATTTCATTGCAAAGAAATCTTCAAAATAATAT
TAATAATAAATGATTAATAATACAAATAATACAGATTACTCAAAAGAAAATGCATATTAT
AGAGATAATTATTCTAAGTAACCATCATCTAATTTGTATAACAATTCAAATTACAACAAT
AACACAGCAAGGGGAAGTAATTAAACAAAACTCTCAAATGGTTAGAACAGTCAAAACATT
TTATCTAACAATGGCCTTGATGGATATGGACATTCAAGTAGTAATAATAATCTTTCTACA
TCTTCAACTTCTTCGACTCAAATACAATAAATACTTTCTAGGTCTCAGAATCTCTAAAAC
AATATAAGCAGCATACCAAATAAAATATCTAAAAATAATAGCTAGGAAACATCTAATTCA
TTCCTTTCGAATGGTTAAAAATCTAAAACTAGTAATAGTTATGTGAGTAACAATCACTCT
AATTCTAATTCTATAGATGAATAAAAACAGTATACTCAAAGTAAAAATCACCTAGTTATT
CTCTAGAAAAAGAATAATAATAGCAATAATAATGTTCCTATGACAGCGAAAGACTCATAA
TCTAAATCATCAAATAATTTGTCATCCCTAAGCTAGTAGTAAAACTAGAGTCAATATAAG
CCCTCTAATGCACCTACATCAGGAATATCTTTCAAATAGCTTCTTAACTAGCAAAATGAA
AGAAAATTACCATCAGCAAATAATTTTTGCTGA


>TTHERM_00971920(protein)
MNMNEIGSDSIICTTENPEQIFSLVEILGQGSYGKVFKALNLQNNKYYAVKVVNTGNGDF
DNLKKEISILQDCQSDYIVHYYGSYLYNEQLWIIMEYCDIGSVNDLMKATQRTLSEVQIA
CILKGVLLGLKYLHNSKKIHRDIKAGNILINKDGACKLADFGVSAQLFNTMGYIESFIGT
PYWMSPEVLTQNKYNKKTDIWSLGITAIEMAEGNPPFSNFQAVSAMILIIKKPPQGLSDP
TKWSQEFNRFVSRCLTINPDIRPTSEELLLDPFIVNNTTRVNPQHFLMNLVSDNMESIRV
FRKNLLEKQKGETQQQGEKKNKQQPAQQQQQEQKKEEKKQVDKRLMTEASHDFQDYIAND
SGTVIEYQNYDQFNNEPDQHQQFYKKQNQFINNNNDKQNNFIWENETGTMVEKLENDDGE
DEEQKDDNLKQPENSDFMKQFSKKEDGFQNINWAQNKKEDSSFSNKPNSNLQKNNSIGNK
SEQREMTSQYNQIEQEDDQVNSSVIIKEDYEIEHIKNQAYSGVAVTDSEKKIQQKNVPDF
VLFAQKMEENNNKNFPKKPLNINIQTDNIHIQVPQSSTPQQQKQQTTKQSISEDSDIPSE
YKNMNEQQIETMIETLKKELEMELKAIQDAYSQKITRCEKALKLVKSKKNGSFTPTSLPM
QLIQIPQNNNFVNQEPISPIKRNINNQLLPQQQQQYLPSPSSTAMKNNLEYLVSSPHLAP
SALPQISQSPYIKNLNLVNGGVYDSNNNSQNLLNGTSSNQIQNKLPNKGFNALQSSNNPM
YTSTNNLVNQSSNNNPLTHLNPVLNNIYSEMPLPATPKTKEQAQQNNGGLNYALGVQTQP
TSSNIYLTSCQKSSNNNSNIAQYTNGQIPVQSQSNQQEDIINNIKRQFQITNSVLGNVES
SNQQQQKQAIINNEMQLRKINSNHPINQLKNSKNNQLFESNMLNKQPSKPTSQNSNFSKG
IQSSSPMITQGGGLSFEEALNRKNILKQNQVQNSSNNNNSTVYDENAIYAQQMQLQQKQR
LQQEQNGSTKAQSYINMSQIPTGTTPNKLSNLDQINILQQKSVQNNNRQIPQTTLYNQAE
RSQTEQSHNDFIAKKSSKQYQQQMINNTNNTDYSKENAYYRDNYSKQPSSNLYNNSNYNN
NTARGSNQTKLSNGQNSQNILSNNGLDGYGHSSSNNNLSTSSTSSTQIQQILSRSQNLQN
NISSIPNKISKNNSQETSNSFLSNGQKSKTSNSYVSNNHSNSNSIDEQKQYTQSKNHLVI
LQKKNNNSNNNVPMTAKDSQSKSSNNLSSLSQQQNQSQYKPSNAPTSGISFKQLLNQQNE
RKLPSANNFC


>TTHERM_00971920(gene)
ATGAATATGAACGAAATAGGAAGTGATAGTATAATATGTACTACAGAAAATCCTGAGTAG
ATATTCAGTTTAGTAGAAATATTAGGTACTAAAAATATTTTAATTGAATTAAATTTATGA
TTTTTATTTTATTTTGTTCAATAACTTTTTATTCTTAATAAGGTCAAGGCTCATATGGAA
AAGTCTTTAAAGCATTGAATTTATAAAACAATAAATATTATGCAGTTAAAGTAGTTAATA
CTGGAAATGGAGATTTTGATAACTTGAAGAAAGAGATTAGTATTTTATAGGATTGCCAGA
GCGATTATATTGTCCATTACTATGGTAGTTATTTATATAACGAATAGTTATGGATTATTA
TGGAATACTGTGATATTGGTAGTGTTAATGATTTAATGAAGGCAACCTAGAGAACACTTA
GTGAAGTTTAGATTGCTTGCATACTTAAGGGTGTACTCCTTGGATTAAAGTATCTTCATA
ACTCAAAAAAAATACACAGAGATATTAAAGCTGGAAATATCCTCATCAACAAAGATGGTG
CATGCAAACTCGCTGATTTTGGTGTATCTGCTTAGCTCTTTAATACTATGGGATACATAG
AATCTTTCATTGGCACTCCTTACTGGATGTCACCTGAAGTAATCAAAATTATTATATTAA
TATAGACTTCATTCAGTACCTAACAGCAGTTAGCTTTCTTTAATTTTAAAAAGATTTGCA
TAAAGCAATAAAAATGTAAAAGGAAACTGAAGGTCTTGCTTGTTTAATTAATTTATGAAT
GATAAAAATTCAAAAATTGAATTTTAAAATTTATTAGAGCAGTTTGTCATTTTAATTCAA
ATATATATTTTCAAATAATTAAAGATTATTTAGAGCGATTTAATAAAAATAATTAACATA
CGCTGGCTATGTTAAAAATCATTTTAAATTTAGTTTTAAAATACTTTGATTAATAATGTT
AAATAAAATATTTTAAAAAAGGTACTAACTTAAAATAAATACAATAAAAAAACTGATATA
TGGAGCTTAGGGATCACAGCTATAGAGATGGCTGAAGGAAATCCTCCCTTTAGCAATTTC
TAAGCAGTTTCGGCAATGATCTTAATTATTAAAAAGCCTCCACAAGGTTTAAGCGATCCT
ACAAAATGGAGTTAAGAGTTTAATAGATTTGTAAGCAGATGTCTAACTATTAATCCTGAC
ATACGCCCAACTTCAGAAGAACTCCTCCTTGATCCTTTTATTGTCAATAACACAACTAGG
GTTAATCCTTAACATTTTTTAATGAATCTAGTTTCTGATAATATGGAGAGTATTAGAGTT
TTTCGCAAAAATTTACTTGAGAAGTAGAAAGGAGAAACTTAGTAACAAGGGGAAAAGAAA
AACAAGTAACAACCTGCATAGTAACAGCAATAAGAATAGAAAAAAGAAGAGAAAAAATAA
GTTGATAAAAGATTAATGACAGAGGCTTCTCATGATTTTTAGGATTACATTGCTAATGAT
AGCGGTACAGTTATTGAATATTAAAACTATGACCAATTTAATAATGAACCTGATCAGCAC
TAATAATTTTACAAGAAATAAAATTAATTTATCAACAATAATAATGATAAATAAAATAAT
TTTATTTGGGAAAATGAGACAGGAACTATGGTAGAAAAATTAGAAAATGATGATGGTGAA
GATGAAGAATAAAAAGATGACAACTTAAAATAACCAGAAAATTCTGATTTTATGAAACAA
TTTTCTAAAAAAGAAGATGGTTTTTAAAATATCAATTGGGCACAAAATAAGAAAGAAGAT
TCTTCATTTTCAAACAAACCAAATTCAAATTTGTAAAAAAATAATTCGATAGGCAATAAA
TCAGAGCAGAGAGAAATGACTTCTTAATATAATTAAATTGAGCAAGAAGATGACTAAGTT
AATAGCTCTGTTATTATTAAGGAAGACTATGAAATAGAGCACATCAAAAACTAAGCTTAT
TCTGGTGTTGCAGTAACAGACTCAGAAAAAAAAATCTAGTAAAAAAATGTACCAGATTTT
GTTTTATTTGCATAAAAAATGGAAGAAAACAATAACAAGAATTTCCCAAAAAAACCTTTA
AATATAAATATTTAAACAGACAATATCCATATTTAAGTACCTTAATCGTCAACTCCTTAA
CAACAAAAATAATAGACTACTAAGTAATCTATCAGTGAAGATAGTGATATTCCTTCAGAA
TATAAGAACATGAATGAGTAATAAATTGAGACCATGATAGAAACACTTAAAAAAGAGCTA
GAGATGGAGCTAAAAGCTATATAAGATGCTTACTCCTAAAAAATTACGAGATGTGAGAAA
GCTTTGAAATTAGTGAAATCTAAAAAAAATGGATCATTCACTCCTACTTCTCTCCCAATG
TAATTAATATAAATTCCTCAAAATAATAACTTTGTAAACTAAGAACCTATTAGTCCTATA
AAAAGAAATATAAATAATCAGTTATTACCTTAATAGTAGTAATAATATTTACCTTCTCCT
TCATCTACGGCTATGAAAAACAATTTAGAATACCTAGTCTCATCACCACATCTTGCTCCA
AGTGCACTTCCATAAATTAGCTAATCTCCATACATCAAAAACCTTAATTTGGTAAATGGA
GGAGTTTATGATTCAAATAACAATAGTTAAAATTTACTTAATGGTACCAGCTCTAACTAA
ATCCAAAACAAACTTCCGAACAAAGGATTTAATGCTTTATAATCAAGCAATAACCCTATG
TATACAAGCACAAATAATTTAGTAAACCAAAGCAGCAATAATAATCCTTTGACTCATTTA
AATCCTGTTTTAAATAATATTTATTCTGAAATGCCATTACCTGCTACTCCAAAAACAAAA
GAATAAGCTTAATAGAATAATGGAGGATTAAATTATGCTCTCGGAGTACAAACACAGCCA
ACTTCTTCTAACATTTATTTAACTAGTTGTTAAAAATCTAGCAATAATAATAGTAATATT
GCTCAATATACAAATGGATAAATTCCTGTTTAATCTCAATCTAACTAGCAAGAAGATATT
ATTAATAATATTAAAAGATAATTCTAAATCACAAATTCTGTTTTAGGAAATGTTGAAAGC
AGCAATCAATAATAATAGAAGTAAGCTATTATAAATAATGAGATGTAATTAAGGAAAATT
AATAGTAATCATCCAATTAACTAATTAAAAAATTCAAAGAATAATTAGCTTTTCGAAAGC
AATATGCTGAATAAATAACCATCTAAACCAACTAGCCAAAACTCTAATTTCTCAAAAGGC
ATTCAATCTTCTTCTCCAATGATCACTTAAGGAGGAGGTCTTTCATTTGAAGAAGCATTA
AATAGAAAGAACATACTTAAGTAAAACTAAGTATAGAATAGCAGTAACAATAACAATAGT
ACTGTCTATGACGAAAATGCAATATACGCTTAATAGATGCAGTTACAGTAAAAGTAAAGG
CTTTAGTAAGAATAAAACGGAAGCACTAAAGCTTAGTCTTATATTAATATGTCATAAATA
CCAACTGGAACTACTCCAAATAAGTTATCAAATTTAGATTAAATTAATATACTCTAGCAA
AAGTCTGTATAAAATAATAATCGTTAAATTCCATAAACCACATTGTATAATTAAGCAGAA
AGATCTCAAACTGAGTAGTCTCATAACGATTTCATTGCAAAGAAATCTTCAAAATAATAT
TAATAATAAATGATTAATAATACAAATAATACAGATTACTCAAAAGAAAATGCATATTAT
AGAGATAATTATTCTAAGTAACCATCATCTAATTTGTATAACAATTCAAATTACAACAAT
AACACAGCAAGGGGAAGTAATTAAACAAAACTCTCAAATGGTTAGAACAGTCAAAACATT
TTATCTAACAATGGCCTTGATGGATATGGACATTCAAGTAGTAATAATAATCTTTCTACA
TCTTCAACTTCTTCGACTCAAATACAATAAATACTTTCTAGGTCTCAGAATCTCTAAAAC
AATATAAGCAGCATACCAAATAAAATATCTAAAAATAATAGCTAGGAAACATCTAATTCA
TTCCTTTCGAATGGTTAAAAATCTAAAACTAGTAATAGTTATGTGAGTAACAATCACTCT
AATTCTAATTCTATAGATGAATAAAAACAGTATACTCAAAGTAAAAATCACCTAGTTATT
CTCTAGAAAAAGAATAATAATAGCAATAATAATGTTCCTATGACAGCGAAAGACTCATAA
TCTAAATCATCAAATAATTTGTCATCCCTAAGCTAGTAGTAAAACTAGAGTCAATATAAG
CCCTCTAATGCACCTACATCAGGAATATCTTTCAAATAGCTTCTTAACTAGCAAAATGAA
AGAAAATTACCATCAGCAAATAATTTTTGCTGA