Identifiers and Description

Gene Model Identifier

TTHERM_00660180

Standard Name

HMGB (High Mobility Group)

Aliases

PreTt23762 | 98.m00105 | 3736.m00006

Description

High-Mobility-Group (HMG) protein; induces negative supercoiling of DNA in vitro; present in both macro- and micronuclei but with elevated expression during both macronuclear S phase and endoreplication of developing new macronuclei

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00505 ) HMG (high mobility group) box

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00660180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17254.15.001636743996964e-56HMG box family protein (147 aa
)
SGDYDR174W0.000006997203421143941HMO1 Chromatin associated high
mobility group (HMG) family m
ember involved in genome maint
enance; rDNA-binding component
of the Pol I transcription sy
stem; associates with a 5-3 DN
A helicase and Fpr1p, a prolyl
isomerase
WormBaseWBGene000221820.0000899730839127287locus:swsn-3 status:Confirme
d UniProt:Q9BL39 protein_i
d:CCD73870.1
OxytrichaContig12963.0.1.g30.00010003404299092957HMG (high mobility group) box
Stentor CoeruleusSteCoe_146190.0024787521766663585

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:8264578: Wu M, Allis CD, Sweet MT, Cook RG, Thatcher TH, Gorovsky MA (1994) Four distinct and unusual linker proteins in a mitotically dividing nucleus are derived from a 71-kilodalton polyprotein, lack p34cdc2 sites, and contain protein kinase A sites. Molecular and cellular biology 14(1):10-20
  2. Ref:8417323: Wang T, Allis CD (1993) An abundant high-mobility-group-like protein is targeted to micronuclei in a cell cycle-dependent and developmentally regulated fashion in Tetrahymena thermophila. Molecular and cellular biology 13(1):163-73
  3. Ref:1480473: Wang T, Allis CD (1992) Replication-dependent and independent regulation of HMG expression during the cell cycle and conjugation in Tetrahymena. Nucleic acids research 20(24):6525-33
  4. Ref:1589033: Lilley DM (1992) DNA--protein interactions. HMG has DNA wrapped up. Nature 357(6376):282-3
  5. Ref:1986218: Schulman IG, Wang T, Wu M, Bowen J, Cook RG, Gorovsky MA, Allis CD (1991) Macronuclei and micronuclei in Tetrahymena thermophila contain high-mobility-group-like chromosomal proteins containing a highly conserved eleven-amino-acid putative DNA-binding sequence. Molecular and cellular biology 11(1):166-74
  6. Ref:1991550: Schulman IG, Wang TT, Stargell LA, Gorovsky MA, Allis CD (1991) Cell-cell interactions trigger the rapid induction of a specific high mobility group-like protein during early stages of conjugation in Tetrahymena. Developmental biology 143(2):248-57
  7. Ref:2476991: Hamana K, Kawada K (1989) Release of nucleosomes from nuclei by bleomycin-induced DNA strand scission. Biochemistry international 18(5):971-9
  8. Ref:2760016: Hayashi T, Hayashi H, Iwai K (1989) Tetrahymena HMG nonhistone chromosomal protein. Isolation and amino acid sequence lacking the N- and C-terminal domains of vertebrate HMG 1. Journal of biochemistry 105(4):577-81
  9. Ref:2514183: Suda M, Hayashi H (1989) A protein that accumulates during starvation in Tetrahymena nuclei. Journal of biochemistry 106(4):612-5
  10. Ref:3671074: Roth SY, Schulman IG, Cook RG, Allis CD (1987) The complete amino acid sequence of an HMG-like protein isolated from the macronucleus of Tetrahymena. Nucleic acids research 15(19):8112
  11. Ref:3109974: Prasanna P, Holmlund CE (1987) Identification in Tetrahymena pyriformis of 3-hydroxy-3-methyl glutaryl coenzyme a lyase: its purification and properties. The International journal of biochemistry 19(4):385-9
  12. Ref:3584238: Schulman IG, Cook RG, Richman R, Allis CD (1987) Tetrahymena contain two distinct and unusual high mobility group (HMG)-like proteins. The Journal of cell biology 104(6):1485-94
  13. Ref:6849878: Levy-Wilson B, Denker MS, Ito E (1983) Isolation, characterization, and postsynthetic modifications of tetrahymena high mobility group proteins. Biochemistry 22(7):1715-21
  14. Ref:6258140: Hamana K, Zama M (1980) Selective release of HMG nonhistone proteins during DNase digestion of Tetrahymena chromatin at different stages of the cell cycle. Nucleic acids research 8(22):5275-88
  15. Ref:117005: Hamana K, Iwai K (1979) High mobility group nonhistone chromosomal proteins also exist in Tetrahymena. Journal of biochemistry 86(3):789-94

Sequences

>TTHERM_00660180(coding)
ATGTCTAAAGCTGCTAGCCAATACGCAACTCTCGAAGATCTCCCCTCCAAGCCCAAGAGA
CCCCAAACCGGTTTCTTCATCTACAAGAGTGAAGTCTTTGCCAAGAGAAGAACTGAGTGC
CCCAACTTGAAGGTCCCTGAAATCGTCTCTAAAATTAGTGAAGAATACAAGGCCTTACCT
GAAAAGGAGAAGTAAAAATACGAAGAAGCCTACAGAAAGGAAAAGGCCACCTACGATAAG
TAAAACGACCAATGGAAAGAGAAGTATGGTGATATCGAAAAGTCCTTGAAGGATTAGGCT
AAGAAGGCCCTCAAGGAAAAGACCAAAAAGTCCAAGGCTGCTGAAAAGGAACTTGAAAAG
AGCAAGAAGAAGGCTCCCGCTGCTGCCCCTGCCAAGAAGGACGATAAGAAGGCTCCCGCT
AAGAAGAAATGA


>TTHERM_00660180(protein)
MSKAASQYATLEDLPSKPKRPQTGFFIYKSEVFAKRRTECPNLKVPEIVSKISEEYKALP
EKEKQKYEEAYRKEKATYDKQNDQWKEKYGDIEKSLKDQAKKALKEKTKKSKAAEKELEK
SKKKAPAAAPAKKDDKKAPAKKK


>TTHERM_00660180(gene)
ATGTCTAAAGCTGCTAGCCAATACGCAACTCTCGAAGATCTCCCCTCCAAGCCCAAGAGA
CCCCAAACCGGTTTCTTCATCTACAAGAGTGAAGTCTTTGCCAAGAGAAGAACTGAGTGC
CCCAACTTGAAGGTCCCTGAAATCGTCTCTAAAATTAGTGAAGAATACAAGGCCTTACCT
GAAAAGGAGAAGTAAAAATACGAAGAAGCCTACAGAAAGGAAAAGGCCACCTACGATAAG
TAAAACGACCAATGGAAAGAGAAGTATGGTGATATCGAAAAGTCCTTGAAGGATTAGGCT
AAGAAGGCCCTCAAGGAAAAGACCAAAAAGTCCAAGGCTGCTGAAAAGGAACTTGAAAAG
AGCAAGAAGAAGGCTCCCGCTGCTGCCCCTGCCAAGAAGGACGATAAGAAGGCTCCCGCT
AAGAAGAAATGA