Identifiers and Description

Gene Model Identifier

TTHERM_00691180

Standard Name

HMG1 (Hydroxymethylglutaryl-CoA reductase )

Aliases

PreTt02956 | 106.m00096 | 3674.m00009

Description

Putative Hydroxymethylglutaryl-CoA reductase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • hydroxymethylglutaryl-CoA reductase (NADPH) activity (IEA) | GO:0004420

Biological Process

Domains

  • ( TIGR00533 ) hydroxymethylglutaryl-CoA reductase (NADPH)
  • ( TIGR00532 ) hydroxymethylglutaryl-CoA reductase, degradative
  • ( TIGR00735 ) imidazoleglycerol phosphate synthase, cyclase subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17618.19.997093137033517e-262hypothetical protein (1367 aa)
OxytrichaContig20054.0.g969.997093137033517e-262Hydroxymethylglutaryl-coenzyme
A synthase C terminal
DictyBaseDDB_G02884614.001794290548151e-138hgsA on chromosome: 5 position
1582464 to 1584009
SGDYML126C1.0000409741368237e-118ERG13 3-hydroxy-3-methylglutar
yl-CoA (HMG-CoA) synthase, cat
alyzes the formation of HMG-Co
A from acetyl-CoA and acetoace
tyl-CoA; involved in the secon
d step in mevalonate biosynthe
sis
WormBaseWBGene000177692.9996277075259347e-88locus:hmgs-1 Hydroxymethylgl
utaryl-CoA synthase status:C
onfirmed UniProt:P54871 pr
otein_id:CCD64508.1
Stentor CoeruleusSteCoe_32158.628801156620959e-60

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691180(coding)
ATGCGTCCTTAAAACGTTGGCATTCACGCCATTGAAACATATTTCCCAAAGACTTTCATT
TCCCAAGAAGAACTAGAACAATTCGATGGTGTTTCTAAAGGAAAATACACAATCGGTCTT
GGATAGAAGTGCATGTCATTTGTTGAACCTTACGAAGATGTAAATTCATTAGCCCTTACA
GTGGTTTAAAACACATTGGAAAAATACAAAATCGACCCTAGAATGATAGGTAGACTTGAA
GTTGGTACAGAAACTCTCATAGATAAATCAAAATCAACTAAGACAGTGTTAATGCAGTTG
TTTAACAAGTATGGCAATCATGATATTGAAGGTATAACTACTATTAATGCATGCTATGGA
GGTACCGCTGCTCTTTTTAATACACTTGCTTGGGTAGAATCTTCAGCTTATGATGGTAAG
AGACTAGGCTGTGTTGTCACAGTCGATGTCGCAGTCTATAAGAAAGGTCCTGCTCGTCCC
ACAGGCGGAGCTGGTGCTATTTGCATGATTATAGGCCCTAATGCTCCAATCATTGTAGAA
CCTATCAGAAGCACCTTTATAGATCATGCATATGATTTTTATAAACCTGATCCTCGCTCA
GAATTCCCAACTGTTGATGGCCATCTATCAATAAATACTTACTTAGGAGCTATTGATAAC
AACTTTAAGACATTGAATTAAAAATATGCAGTTGCCAACCTTCGTCCTTTCTCCCTTTAA
GATGTGGATTATGGTTGTTTCCATGCTCCTTTTGCAAAAATGGTTTAGAAAGCATTTGTT
CGTTTGTTTTATAATGATGTATTGAGTGGATATAATAAAGAAGTTAAAATTTCTGAAGAA
GATTATCTCACATTAAAAAATAGTGATTACAATAGCAAAGAAGTAACAGAAAAGCTTTCC
AAGCTTTCATCTTAAACCTGGAATCAAAAAGTAAAGCCAAGCTTATTAATGGGAGAGAAT
TTGGGCAATATTTACACAGGATCTTTATATGCTGGACTATGCTCACTTATCAGTGATGAT
AATATAGACCTCAGAAATAAAAGAATTTTGATGTTTTCTTATGGGTCTGGATTAGCATCT
TCCATGTTCTTCTTGAGGGTTGGTGAAGATTACTCATTCATTAAGTCTGTTATTAACCTT
AAAGAAAGACTTTCTTAGAGAATAAAAATCCCCATTCAGGAATATGATTAAATAATGGCT
GAAAGAGAAAAAGCATTTGGTTTTCTTCCTTCAAACCCAAAAGTAAACTTTGAAAGGTTA
GGTGAAGGAGTATTTTTCTTAAGCTCAGTAGATAAAATGTGGAGACGTTAATATGAAAGA
TATTAGGAGTAAACAACTTTTGTGAAGTCAAACTAAGTTAGTAAAAACAATTGCAGTTCA
ACCAATCTCATTGATATGAACAAAGTAGTAATTATTGATGACATCAGTTTCAATGAATAA
AAGGCTCGTTTGAACGATAGACTTGTTCAAATCAAAAATTAAATTGTTAACAAAGGAAGT
TCTTCATCTTTAAACAAAGATTTGAAAGCAGGAGCAAGTAGAAAGCGCTCTCATTCTCAA
GAAAAAAATCTGAACTAAAAAATTTGGTCAGGATTTTACAAGAAGACTTTGAAAGAAAGA
CTTGATTAAATTTAGAAAGTTGAGCCTAAAATTGACACTTAAAAATTCGAAGATGGCGGA
CTTACCTTATAAAGAGCTGATTTAATGGTCGAGAATTGCATAGGTAAGATTTCCCTCCCA
ATTGGTCTTGCTTTAAACTTTAAGATAAATGATAAATATCTCAATATTCCTATGGCTATT
GAAGAACCCTCTGTTATCGCTGCTGCATCCTCATCTGCTAAATTTATTGATGAAAATGGA
AGCGGATTTTCGACTTATTCAACTCGCCCAATTATGATCGGCTAAATCTAACTTCTTTAA
GTTGATCCTCTCTAGGTTTAATACAAATTAGATTAAAATAAAGAGAAGATTATTTCTTAC
GCAAATGAAATTTGTTAAACAATGGTCAACAGAGGAGGAGGTGTTAAGGATCTTAAAGTT
AAAATCTTAAATGCAACAGATAAAAAATTGAAATCAACTGGTGAGTATCAAGTAGATGAA
ATGGTAGTTGTAGATTTACATATTAATGTATGCGATGCTATGGGTGCAAATATTGTAAAT
ACTATCGTAGAATATACTGCACCATTAATTGAGTAAATTACAGGAGGCAGAGCAGGATTA
AAAATTTTATCTAACTTATGCACTGAACGTCGTGCTGTTTCTGAATTTGAAATTCCTATT
TCAAAATTATCTTGGAAAGATGCAAGCGGTGAAGATGTTGCTAAAAGAATCATAGAAGGA
TATCGCTTTGCTTAGCTTGATCCATACCGTGCATCTACTCATAATAAAGGTATATTTAAT
GGAATGGATGCAGTAGCAATTGCTACAGGATAAGACTGGAGATCTATTGAAAGCTCTTGC
CACACTTATGCCAGTATTAATAATAAAAAAGCTGGATATCAACCACTCACACACTACGAA
ATTATAAGAAGTAAGCGCCCTAACTTCTAAGGTGAACTAGTACTCAGAGGTATGATAGAA
GTGCCTATATCTGTTGGATCTTAAGGAGGTGTTTTAAGCGCTAATCCACTATATCATAAT
AATCTTTAACTTCTTGGATTCCCTAATGCATAATAATTATCTGAAATAATTGCTACTGTC
GGTCTTTGCTAAAATTTTGGTGCTTTGCGTGCTCTTGCTGTAGAAGGAATTTAAAAAGGA
CATATGAATCTCCATGCTAGAAATATTGCTTTAGCTGGTGGAGTACCTACCCATCTCGTC
GAAGAAGCTACTCGCTTTATGAAATCTCGTGGTAAAATAAATGTTGATACAGCAAAGGCA
TACCTCGAAGCACATGATATGTTTGAGCAAGTTAGGGAGTAAAATGTGAGTGAAATTCAA
AAGCACACTCCATTAAGCACATTTTATGTTGAGCTTGATAATGAATTTCTCGAAGAACCC
ATCACTCTTCACGTTGCTATTGAGTGCCTTGATTTCGATAAATAACCTATTCATCTTTCA
ATCGAGCCTTCTTCAAATTCTAATGGAAACCAAAACAATAAAAATTAAAACACAATAAAT
AAGAATATTCAAGACCTTCTCTTTGGACCTAAAGGAAATGAATGGCTTCGCTAAATTTTC
TCAGCACTTGAGATTGTTAGATTCAAACTAAATAAAAAGAACAGTGAAAATTCAAATAAA
AATCTACCTACTTCTAAATAAGTTTACAGATTAAAACTTATTACCATCATTATTAATTTA
TTAACTAGTAGCTTGATACAATTGGATTTTGAGTGTTCCTCCTTTGTTATTTAAGAATTA
ATTTACTTCTTCAAGAACAATAATAAGAACATGAAAAACATCAACGTTGAAAGCTTAATT
TCTGCAAAAAAATAATCTAAAATAGGTTTAAGCGAGTAAGAAAAAGTCAAGTAGCTCGCT
TTAATATTTGGATTGAATTTATTAAGTGAGTGCATTCGTATTTTTAAGTACAATAATGAC
AGAGCTCATATTGCTGATGAATATTTAGAAAACCATTTAATGAAAGAACTCTTTAACATC
ATTGAAAGCCAGATCTAAGCTTACAATTTATGGAAGTAGGTATAAGGAACCACCCAGACT
AAAAATTTGAATATAGAGAAATTTATTGAAAATCGCCAAAAGCGCTTATGCTCAACTATG
ATGCTCCTTTGCGATTGTGTGGACTTAAATCCTAATTCCATCAATCCAAACATAATGAAT
GTCATTTATAGACTAGGTTAGGTTTATGAGTTAGAAATCACTATGATTCATGATGTGTAA
AAGTGGAAGCCAAGTCTAGATGAAATAAATCTTTATTCATACTGGCTCATTTAAAACAAC
TTATTTAGTCAAGGGGAAGCAATAGAAAATCGTAAAGCTTTCATATAATATATAACTAAA
ATTCTCAAATAGAAAAAGTAAGATTTGCAATCTTTGCTAGACAATAAATTAAAAACTTTG
TGCGAAATAACATCAGAAGTGATTCACTCATATTACAACTTCGATCAAAAATAATTGGTT
ACTCCAAAACTTTGA


>TTHERM_00691180(protein)
MRPQNVGIHAIETYFPKTFISQEELEQFDGVSKGKYTIGLGQKCMSFVEPYEDVNSLALT
VVQNTLEKYKIDPRMIGRLEVGTETLIDKSKSTKTVLMQLFNKYGNHDIEGITTINACYG
GTAALFNTLAWVESSAYDGKRLGCVVTVDVAVYKKGPARPTGGAGAICMIIGPNAPIIVE
PIRSTFIDHAYDFYKPDPRSEFPTVDGHLSINTYLGAIDNNFKTLNQKYAVANLRPFSLQ
DVDYGCFHAPFAKMVQKAFVRLFYNDVLSGYNKEVKISEEDYLTLKNSDYNSKEVTEKLS
KLSSQTWNQKVKPSLLMGENLGNIYTGSLYAGLCSLISDDNIDLRNKRILMFSYGSGLAS
SMFFLRVGEDYSFIKSVINLKERLSQRIKIPIQEYDQIMAEREKAFGFLPSNPKVNFERL
GEGVFFLSSVDKMWRRQYERYQEQTTFVKSNQVSKNNCSSTNLIDMNKVVIIDDISFNEQ
KARLNDRLVQIKNQIVNKGSSSSLNKDLKAGASRKRSHSQEKNLNQKIWSGFYKKTLKER
LDQIQKVEPKIDTQKFEDGGLTLQRADLMVENCIGKISLPIGLALNFKINDKYLNIPMAI
EEPSVIAAASSSAKFIDENGSGFSTYSTRPIMIGQIQLLQVDPLQVQYKLDQNKEKIISY
ANEICQTMVNRGGGVKDLKVKILNATDKKLKSTGEYQVDEMVVVDLHINVCDAMGANIVN
TIVEYTAPLIEQITGGRAGLKILSNLCTERRAVSEFEIPISKLSWKDASGEDVAKRIIEG
YRFAQLDPYRASTHNKGIFNGMDAVAIATGQDWRSIESSCHTYASINNKKAGYQPLTHYE
IIRSKRPNFQGELVLRGMIEVPISVGSQGGVLSANPLYHNNLQLLGFPNAQQLSEIIATV
GLCQNFGALRALAVEGIQKGHMNLHARNIALAGGVPTHLVEEATRFMKSRGKINVDTAKA
YLEAHDMFEQVREQNVSEIQKHTPLSTFYVELDNEFLEEPITLHVAIECLDFDKQPIHLS
IEPSSNSNGNQNNKNQNTINKNIQDLLFGPKGNEWLRQIFSALEIVRFKLNKKNSENSNK
NLPTSKQVYRLKLITIIINLLTSSLIQLDFECSSFVIQELIYFFKNNNKNMKNINVESLI
SAKKQSKIGLSEQEKVKQLALIFGLNLLSECIRIFKYNNDRAHIADEYLENHLMKELFNI
IESQIQAYNLWKQVQGTTQTKNLNIEKFIENRQKRLCSTMMLLCDCVDLNPNSINPNIMN
VIYRLGQVYELEITMIHDVQKWKPSLDEINLYSYWLIQNNLFSQGEAIENRKAFIQYITK
ILKQKKQDLQSLLDNKLKTLCEITSEVIHSYYNFDQKQLVTPKL


>TTHERM_00691180(gene)
ATGCGTCCTTAAAACGTTGGCATTCACGCCATTGAAACATATTTCCCAAAGACTTTCATT
TCCCAAGAAGAACTAGGTATATTTCATTTTTATTATTTCTAAATTCTATAGGTTTCTGTT
TTCATACTCTTTAAGCTATATTTTTAAGGAGCAATTAAAACAATAAGATAAATCAAGCTT
TTAACTTTTATGAAAAAATTGAGATTTCCTTAATATTTTTCATCATTTTAAAGCCATTAA
ATATGAGATAATATAGTTTAATCGATTCTATTTCACTAATTATAAAAATAGTGATTTAAT
TTTTAAGCTTTCAAAATTTATACTAATTTTTCTCTTTAAACTTTTCGAACATTTTAATCA
TTACTAAATAGAACAATTCGATGGTGTTTCTAAAGGAAAATACACAATCGGTCTTGGATA
GAAGTGCATGTCATTTGTTGAACCTTACGAAGATGTAAATTCATTAGCCCTTACAGGTAA
TTACAAGCATATATATATTTAAATATTTAAAGTTTAATCTTTGCTAAATATAAACAAATT
ATTAATAGTGGTTTAAAACACATTGGAAAAATACAAAATCGACCCTAGAATGATAGGTAG
ACTTGAAGTTGGTACAGAAACTCTCATAGATAAATCAAAATCAACTAAGACAGTGTTAAT
GCAGTTGTTTAACAAGTATGGCAATCATGATATTGAAGGTATAACTACTATTAATGCATG
CTATGGAGGTACCGCTGCTCTTTTTAATACACTTGCTTGGGTAGAATCTTCAGCTTATGA
TGGTAAGAGACTAGGCTGTGTTGTCACAGTCGATGTCGCAGTCTATAAGAAAGGTCCTGC
TCGTCCCACAGGTATATATCTTAAAATTAAGTTAAGTAACAAAATAATAAATATTTATAT
TTTATTTAAATAGGCGGAGCTGGTGCTATTTGCATGATTATAGGCCCTAATGCTCCAATC
ATTGTAGAACCTATCAGAAGCACCTTTATAGATCATGCATATGATTTTTATAAACCTGAT
CCTCGTAAGAAAATTGTTTAATCAAATTAATTTGTTTACTTTTCGATTAAACAATTTAAT
AAAATTATTAATTTAATTCGTATTCAATTAGAAATTTCTATGGTAAAGATAGCAGATATC
AAAAATACCTCAAATTAAAAATTTAAAAGCAACAATTAAAACCAATGAAATTCAACATTT
ATTTTATGAATCTAAATAAAATAATTTAAATTTTTTTTTTAATTTCAAATTAGGCTCAGA
ATTCCCAACTGTTGATGGCCATCTATCAATAAATACTTACTTAGGAGCTATTGATAACAA
CTTTAAGACATTGAATTAAAAATATGCAGTTGCCAACCTTCGTCCTTTCTCCCTTTAAGA
TGTGGATTATGGTTGTTTCCATGCTCCTTTTGCAAAAATGGTTTAGAAAGCATTTGTTCG
TTTGTTTTATAATGATGTATTGTAAGTTAATCTCATTTGAAAATAAAAAAATTCAAAATA
AAATTTATCAAAAAAGGAGTGGATATAATAAAGAAGTTAAAATTTCTGAAGAAGATTATC
TCACATTAAAAAATAGTGATTACAATAGCAAAGAAGTAACAGAAAAGCTTTCCAAGCTTT
CATCTTAAACCTGGAATCAAAAAGTAAAGCCAAGCTTATTAATGGGAGAGAATTTGGGCA
ATATTTACACAGGATCTTTATATGCTGGACTATGCTCACTTATCAGTGATGATAATATAG
ACCTCAGAGTAAGATATTTAAATTATCTTTTAAATATTTTTATTGATTTATATGAAAGAA
TTGTTTTAAATAATTTCGTTTTAATGTTGAAAAATAAAATTATTTATTTTAGAATAAAAG
AATTTTGATGTTTTCTTATGGGTCTGGATTAGCATCTTCCATGTTCTTCTTGAGGGTTGG
TGAAGATTACTCATTCATTAAGTCTGTTATTAACCTTAAAGAAAGACTTTCTTAGAGAAT
AAAAATCCCCATTCAGGAATATGATTAAATAATGGCTGAAAGAGAAAAAGCATTTGGTTT
TCTTCCTTCAAACCCAAAAGTAAAAATTTTTAAAGAACAATTTTAACTAAATTTCATTGA
CACACCAAAACATTACTTACGAACCAATCTTTGAATATTTTGATACAGTAGAAGATAAAT
GTTTATTTATTTTTCAATAAATTAATTAAATCTATATTTTTGTGTGGTTAATCAAATAGA
AAGATATTTCATATATTGATGAATTCTATTTAGATGAATTTAATTTATTTGAATTGGCAA
TCTTTAATTAAAAAGCTTAGCTAATAATTTAGAAAATATGTTTTTAATTTTTCTAAAAAT
AATTAATTAAAAAGGTAAACTTTGAAAGGTTAGGTGAAGGAGTATTTTTCTTAAGCTCAG
TAGATAAAATGTGGAGACGTTAATATGAAAGATATTAGGAGTAAACAACTTTTGTGAAGT
CAAACTAAGTTAGTAAAAACAATTGCAGTTCAACCAATCTCATTGATATGAACAAAGTAG
TAATTATTGATGACATCAGTTTCAATGAATAAAAGGCTCGTTTGAACGATAGACTTGTTC
AAATCAAAAATTAAATTGTTAACAAAGGAAGTTCTTCATCTTTAAACAAAGATTTGAAAG
CAGGAGCAAGTAGAAAGCGCTCTCATTCTCAAGAAAAAAATCTGAACTAAAAAATTTGGT
CAGGATTTTACAAGAAGACTTTGAAAGAAAGACTTGATTAAATTTAGAAAGGTGAAATAT
CTAATAATTAACAATTTATCATAAATACATAATTGGTTTAACCCAGCTTATGAGGATATT
GATATTTGTTCATCCCTTCATTTAATCTTATTTATTAAGCAAATTTATTAAAATAAAGAA
AAACTCACATAGTACATTAGCATATAAACTTAAGAATGTAGATAGATAAATATTTAAAAT
AAAAAGGCATCAATCAAATAAATGATAAATAATCTAATTTTTATATAAAACCCCCATACT
TAAGAATTATTGACCATATTGTTTATTATCAATCTTATCCTATAGCAGCAGCATTCATTC
GCACTTCATCCATAATGACATTTTCTAAACCCATAAGTCAATACTAAAAAAAAAAGAGAC
TTTAATAAATAACTTCATTTAAAAATAAGCTAATCAAAAGTTTATTTGAACACAGAAGCA
TTTATCATAATAATTCTAACTTAAGAAAGAGATGAATGAAATAGTGTACTGCCTAATAGG
ATTAAATTTAAATTATATTCCTAATATGTAACCAAACACTCTATTATTCTTTTGTTTTAT
TAAATAGGCAATTTAATTTAATTTAATTCAATTAATAATTAATTTTGTTAATTCTTTTAT
TTATTATTTTCTTCATCTTCTTTTTAGAAAATGTTAGTTAATTAGTTATCAAACAAGATC
AGTTTTTTTGACAATAACTTATTTTATCTAGATTAAATATTTAATTGATACAATAAAATT
AATTTACACTTGCTATTAAATAAAGATTAAATCAATTTTATTTTTCATCCATCATAATTA
TTAAACCAAGTATTTTCAATCAATCAATTAATCAATCAATCAATCAATCAAACAAACTCA
ATTATTTTTAGCTATTATTAATTTTTTAATTTTACTAAAATAGTTGAGCCTAAAATTGAC
ACTTAAAAATTCGAAGATGGCGGACTTACCTTATAAAGAGCTGATTTAATGGTCGAGAAT
TGCATAGGTAAGATTTCCCTCCCAATTGGTCTTGCTTTAAACTTTAAGATAAATGATAAA
TATCTCAATATTCCTATGGCTATTGAAGAACCCTCTGTTATCGCTGCTGCATCCTCATCT
GCTAAATTTATTGATGAAAATGGAAGCGGATTTTCGACTTATTCAACTCGCCCAATTATG
ATCGGCTAAATCTAACTTCTTTAAGTTGATCCTCTCTAGGTTTAATACAAATTAGATTAA
AATAAAGAGAAGATTATTTCTTACGCAAATGAAATTTGTTAAACAATGGTCAACAGAGGA
GGAGGTGTTAAGGATCTTAAAGTATATTTATTACTTATCATAAATTAAATTTAGCTTTTA
AAGACTTTATGCTAAAGGTTTTTTTAATATTTTTATTTAACATAAAAGGTTAAAATCTTA
AATGCAACAGATAAAAAATTGAAATCAACTGGTGAGTATCAAGTAGATGAAATGGTAGTT
GTAGATTTACATATTAATGTATGCGATGCTATGGGTGCAAATATTGTAAATACTATCGTA
GAATATACTGCACCATTAATTGAGTAAATTACAGGAGGCAGAGCAGGATTAAAAATTTTA
TCTAACTTATGCACTGAACGTCGTGCTGTTTCTGAATTTGAAATTCCTATTTCAAAATTA
TCTTGGAAAGATGCAAGCGGTGAAGATGTTGCTAAAAGAATCATAGAAGGATATCGCTTT
GCTTAGCTTGATCCATACCGTGCATCTACTCATAATAAAGGTATATTTAATGGAATGGAT
GCAGTAGCAATTGCTACAGGATAAGACTGGAGATCTATTGAAAGCTCTTGCCACACTTAT
GCCAGTATTAATAATAAAAAAGCTGGATATCAACCACTCACACACTACGAAATTATAAGA
AGTAAGCGCCCTAACTTCTAAGGTGAACTAGTACTCAGAGGTATGATAGAAGTGCCTATA
TCTGTTGGATCTTAAGGAGGTGTTTTAAGCGCTAATCCACTATATCATAATAATCTTTAA
CTTCTTGGATTCCCTAATGCATAATAATTATCTGAAATAATTGCTACTGTCGGTCTTTGC
TAAAATTTTGGTGCTTTGCGTGCTCTTGCTGTAGAAGGAATTTAAAAAGGACATATGAAT
CTCCATGCTAGAAATATTGCTTTAGCTGGTGGAGTACCTACCCATCTCGTCGAAGAAGCT
ACTCGCTTTATGAAATCTCGTGGTAAAATAAATGTTGATACAGCAAAGGCATACCTCGAA
GCACATGATATGTTTGAGCAAGTTAGGGAGTAAAATGTGAGTGAAATTCAAAAGCACACT
CCATTAAGCACATTTTATGTTGAGCTTGATAATGAATTTCTCGAAGAACCCATCACTCTT
CACGTTGCTATTGAGTGCCTTGATTTCGATAAATAACCTATTCATCTTTCAATCGAGCCT
TCTTCAAATTCTAATGGAAACCAAAACAATAAAAATTAAAACACAATAAATAAGAATATT
CAAGACCTTCTCTTTGGACCTAAAGGAAATGAATGGCTTCGCTAAATTTTCTCAGCACTT
GAGATTGTTAGATTCAAACTAAATAAAAAGAACAGTGAAAATTCAAATAAAAATCTACCT
ACTTCTAAATAAGTTTACAGATTAAAACTTATTACCATCATTATTAATTTATTAACTAGT
AGCTTGATACAATTGGATTTTGAGTGTTCCTCCTTTGTTATTTAAGAATTAATTTACTTC
TTCAAGAACAATAATAAGAACATGAAAAACATCAACGTTGAAAGCTTAATTTCTGCAAAA
AAATAATCTAAAATAGGTTTAAGCGAGTAAGAAAAAGTCAAGTAGCTCGCTTTAATATTT
GGATTGAATTTATTAAGTGAGTGCATTCGTATTTTTAAGTACAATAATGACAGAGCTCAT
ATTGCTGATGAATATTTAGAAAACCATTTAATGAAAGAACTCTTTAACATCATTGAAAGC
CAGATCTAAGCTTACAATTTATGGAAGTAGGTATAAGGAACCACCCAGACTAAAAATTTG
AATATAGAGAAATTTATTGAAAATCGCCAAAAGCGCTTATGCTCAACTATGATGCTCCTT
TGCGATTGTGTGGACTTAAATCCTAATTCCATCAATCCAAACATAATGAATGTCATTTAT
AGACTAGGTTAGGTTTATGAGTTAGAAATCACTATGATTCATGATGTGTAAAAGTGGAAG
CCAAGTCTAGATGAAATAAATCTTTATTCATACTGGCTCATTTAAAACAACTTATTTAGT
CAAGGGGAAGCAATAGAAAATCGTAAAGCTTTCATATAATATATAACTAAAATTCTCAAA
TAGAAAAAGTAAGATTTGCAATCTTTGCTAGACAATAAATTAAAAACTTTGTGCGAAATA
ACATCAGAAGTGATTCACTCATATTACAACTTCGATCAAAAATAATTGGTTACTCCAAAA
CTTTGA