Identifiers and Description

Gene Model Identifier

TTHERM_00046490

Standard Name

HIR1 (HIstone Regulation)

Aliases

PreTt11128 | 3.m01786 | 3824.m02889 | HIRA

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00046490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01798.19.997093137033517e-262hypothetical protein (1046 aa)
WormBaseWBGene000196275.0000961330688895e-23Protein HIRA homolog status:
Partially_confirmed UniProt:
Q09589 protein_id:CCD72856.1
DictyBaseDDB_G02764237.000255027549774e-17hira on chromosome: 2 position
6881531 to 6885323
OxytrichaContig429.1.g1210.00000000000001000191320216021WD domain, G-beta repeat
SGDYBL008W0.000000000000020000882446601127HIR1 Subunit of the HIR comple
x, a nucleosome assembly compl
ex involved in regulation of h
istone gene transcription; con
tributes to nucleosome formati
on, heterochromatic gene silen
cing, and formation of functio
nal kinetochores

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046490(coding)
ATGTCATTTAATGTATCTTTAAAATATGAGGTCTTCTCATTCCATGAAGAAATTATAAAA
TCAATTAACTTTTAAAATTAAGGAAATGTTTTAGTATTTTGTAGTGGCTAGGATAACGAT
TAGTTGAAGATAGTTAAAACTACTATAAATTAAGACTACATGAATTAGAATGTTACAAAT
AAAGTTGATTTCTAGCCACTGAATATTAGGAGCGTTTAGAGTTCTAATCTTATTAAATGG
AGTCCAAACGATCAGTTTTTGGCAGCTGCTTTTGAAAAGTTAGGAATTTGGGGATATGCA
AATGGAGACATTTATAAATTAAAAGATTTTAAAGACCACGAGTTAGAAATCGCAGCAATC
ACATGGGCACCTGATTCATCTCGTATTGCTTCAGGTGGTTTAGATGGAAAAATTGTAGTT
AGATCAGTTGATATTGCTAAGAATTATGAAAAAATAAAAGAATTGAGTCATGATAATAAG
ATTTTAGGTCTAGTTTGGGATACATATGATAAATATTTAGCAGCTCTATATTCAGATAAT
AATGTCATCATTTGGAAGTGTAATTCATGGGAAAAGTCATTTATTGTTTCTTTGACTTGT
CCTATTTCATCTGACATCTCTAAGATCACTTCAAAAAGAGATGACAGAAAAATAGATTGG
TCTCCTGATTACAGGTATGTACTTGTTCCTAGTTTAGATGATAAAATTGTGCCCTTTGTG
TGTGCTCTAGATAGATAAAAAGATTTTAAAGTTTGTAAAACATTTATGGGGCCTTTTTCA
TCTATAAACTGTGTAAAATTCAATCCTAATTTGTATGAAAATAAAGAAAGCGTTATTAAT
GTATTTGCACTTGGAGATAATGACGGTAATATATCAATTTGGGGTATAGGAGATGGTTAC
CAAGCTAAAAAACCTTTCTTTTTGTTTAAATCTCACCCTAATGGAAATGAGTTAATTGAA
GATATTTGTTGGAATGCTGAGGGAAATATGTTGATAGCAACTACATTAAAAAAGTATGTG
TTTTTAGCTTTATTTGGAGAAACTGTATTTGGGTCTAAACTAAGCCCTCAATAAAAGTAA
GATTTTTTGGAAGGAAAATATGGAACATTGAGAACTGTAGCAGCCACAAATATGAAGTTT
AAAGTATTTAAAGCAACATAGTAAGAAGAGGAAGAGGAATAAAAAAATAAAGAAAAGCAA
CTCTTTGAAGCTAAAGGTGATAATAAATAAATTGATTCTATCCTTGGAAGAGGAAATAAC
AATGGCAAAACAGCTACTTAATTTGGAAGTTCAAATAGCACAAATTAAAATGCTGATTAA
AATTAAGAAGTTTTAACAAGTATCTCATATACAGAGCAAAAGACTCTAAATGAAGGAGGG
AAAAAAAGAATTATTCCTAGCAAGTAAATCATATCTAAAGTTGTTGTTGAAAAGAAACCA
GAAGAAGAACAAAAAAGTAACGAAAATAATAAAATGATAGAGGAAAAGCCATTAGAGAAT
AATTAAAATATACCAAAAGCAGATAATTAAATTGATGTTAAAAGTTAAACATAATAAAGC
AGTTCGATATAAGAAAAAGAATCTAATATTGAAGAAGGTAAGGTAAAACCAATAGATACC
AATGATAGCAAGAAAATGGAAATAGAAACTATTCCTGTTCCTTCCAATTAAAATTAAATT
AATAATAAAGATGAAAGTAAAAAAATGGAAGAAGAAAAGAAGCCTTCCTAGCCAACTAGT
TAAAATAACACAAATTAAACTGCTGTTCAAAATTAGACAAACCTGAGTACAACCGTTAAG
AGCATAGATCATGCTAAAAAAGACTTAAAAGATCCTAAAAAATCTTTATAAAAAACAAAT
GTTGTACCATCTGTCACAGGTTCAAGCACATAAGGAGGATCAAATGCAAATTAATCCAAA
GACCAATAAAGCAAAAATATTGAAAACGCTCAATTCATTGAAGAATAAGAAAAATTATAA
GAAACTGTGAAACTTAAAGTTCCTTAACCCATTCCAAATATACATACAATGCGTATTTCA
TAAGCTGAAATTAAATTTTTGGAAATTGAAACACCTTAAAATTAACTGAATGCTCCATTA
ACCACATAAATTCGTTGCACAATCTTAAAAAATAATGCTAAAGAGATATTATGGAATGAC
TGTATAGAAGGAAAGCTACTTTTTGTAGAAATATATAATGATTAATTAATTTACTACACA
TCTTCACACTTGCTGTATTTCGTAAATTCATTAAATGGAAGAAGAAGTGAACTTCCTTTG
TTAATTCCAAATATTTGCTGGTTAAAATTAAATAAGTCTAACTAAATGATGAGTCTTTCT
GAAAATGGTGATGTTAAAGTCTATGACAATAATATTAAAAAACTTATAATAAACGAGAAT
ATTATGTTCCTATTAAAAGAAAATCTAAAAATGTTATCTTAGAATTAAGATTTACCAGAC
TCAGGTTCAAAAGATCCAATAGAAAATGTAACACTGGATAATAATGGAGTACCAATAATT
TTCTTTAAGACTAGGAATGTTTATATTTTTAATGTTCCAATGAAAACTTGGCAAAAAATA
GACAACTTTAATATAGAAATAGGGTGCTTTTATGATGCAAGTTAACTCTTATCAAAAGAT
AATAAAGGAGATAGTAGCGTTGCTGCTATCAAAGAGGCTGAAGACTTGGGCTAATTCTTT
GAAAAGTTAATAGAAGTGAGCCCTGGAGAGCTTGAACTAGAAAACAGAAAAGATGTTAGC
ATAGTTTCTAAATATGAAGAAAGATTAATTTATCTAATGAAATATGATGAAAAAAAGAGC
TCAGATGTATTCATTGAAACTACTTCAAAGTATATTAAAAAATTATGCGATTTAAGGGAA
TTTAATAAAATAAGATAATTCATAGCTGACTTCTTCTGCAACACAAATACTTAAGAGTAT
TAGTTTATGAAGAAAAATAACATTGACTCAACAAAGCTATTTAAAAATATAAAAAGAATA
CTTGACTATTTCCCTTATACAAGTGATTTATCTTCTGAAATAGAAGAAATCATTTAATTT
AAAGGAAAATCTAATTGA


>TTHERM_00046490(protein)
MSFNVSLKYEVFSFHEEIIKSINFQNQGNVLVFCSGQDNDQLKIVKTTINQDYMNQNVTN
KVDFQPLNIRSVQSSNLIKWSPNDQFLAAAFEKLGIWGYANGDIYKLKDFKDHELEIAAI
TWAPDSSRIASGGLDGKIVVRSVDIAKNYEKIKELSHDNKILGLVWDTYDKYLAALYSDN
NVIIWKCNSWEKSFIVSLTCPISSDISKITSKRDDRKIDWSPDYRYVLVPSLDDKIVPFV
CALDRQKDFKVCKTFMGPFSSINCVKFNPNLYENKESVINVFALGDNDGNISIWGIGDGY
QAKKPFFLFKSHPNGNELIEDICWNAEGNMLIATTLKKYVFLALFGETVFGSKLSPQQKQ
DFLEGKYGTLRTVAATNMKFKVFKATQQEEEEEQKNKEKQLFEAKGDNKQIDSILGRGNN
NGKTATQFGSSNSTNQNADQNQEVLTSISYTEQKTLNEGGKKRIIPSKQIISKVVVEKKP
EEEQKSNENNKMIEEKPLENNQNIPKADNQIDVKSQTQQSSSIQEKESNIEEGKVKPIDT
NDSKKMEIETIPVPSNQNQINNKDESKKMEEEKKPSQPTSQNNTNQTAVQNQTNLSTTVK
SIDHAKKDLKDPKKSLQKTNVVPSVTGSSTQGGSNANQSKDQQSKNIENAQFIEEQEKLQ
ETVKLKVPQPIPNIHTMRISQAEIKFLEIETPQNQLNAPLTTQIRCTILKNNAKEILWND
CIEGKLLFVEIYNDQLIYYTSSHLLYFVNSLNGRRSELPLLIPNICWLKLNKSNQMMSLS
ENGDVKVYDNNIKKLIINENIMFLLKENLKMLSQNQDLPDSGSKDPIENVTLDNNGVPII
FFKTRNVYIFNVPMKTWQKIDNFNIEIGCFYDASQLLSKDNKGDSSVAAIKEAEDLGQFF
EKLIEVSPGELELENRKDVSIVSKYEERLIYLMKYDEKKSSDVFIETTSKYIKKLCDLRE
FNKIRQFIADFFCNTNTQEYQFMKKNNIDSTKLFKNIKRILDYFPYTSDLSSEIEEIIQF
KGKSN


>TTHERM_00046490(gene)
ATGTCATTTAATGTATCTTTAAAATATGAGGTCTTCTCATTCCATGAAGAAATTATAAAA
TCAATTAACTTTTAAAATTAAGGAAATGTTTTAGTATTTTGTAGTGGCTAGGATAACGAT
TAGTTGAAGATAGTTAAAACTACTATAAATTAAGACTACATGAATTAGAATGTTACAAAT
AAAGTTGATTTCTAGCCACTGAATATTAGGAGCGTTTAGAGTTCTAATCTTATTAAATGG
AGTCCAAACGATCAGTTTTTGGCAGCTGCTTTTGAAAAGTTAGGAATTTGGGGATATGCA
AATGGAGACATTTATAAATTAAAAGATTTTAAAGACCACGAGTTAGAAATCGCAGCAATC
ACATGGGCACCTGATTCATCTCGTATTGCTTCAGGTGGTTTAGATGGAAAAATTGTAGTT
AGATCAGTTGATATTGCTAAGAATTATGAAAAAATAAAAGAATTGAGTCATGATAATAAG
ATTTTAGGTCTAGTTTGGGATACATATGATAAATATTTAGCAGCTCTATATTCAGATAAT
AATGTCATCATTTGGAAGTGTAATTCATGGGAAAAGTCATTTATTGTTTCTTTGACTTGT
CCTATTTCATCTGACATCTCTAAGATCACTTCAAAAAGAGATGACAGAAAAATAGATTGG
TCTCCTGATTACAGGTAATTTTAGTATATAAATAAACGTGTCTAGTATTTGTTATTTAAA
GCTTATTATTTTAAGATCGATCTTTGAATTTGCTAAAAATTCCATGAAAACTAATTTTTT
TATTTCAAAAGCAGCAAACAAACTAATGAATTTATATATATATCTTTATATTTTTTAATA
CTTTGATTTAGAGATTATAACATCAAGTAGAAACAATTAATGTTTAATTTATAAATAGGT
ATGTACTTGTTCCTAGTTTAGATGATAAAATTGTGCCCTTTGTGTGTGCTCTAGATAGAT
AAAAAGATTTTAAAGTTTGTAAAACATTTATGGGGCCTTTTTCATCTATAAACTGTGTAA
AATTCAATCCTAATTTGTATGAAAATAAAGAAAGCGTTATTAATGTATTTGCACTTGGAG
ATAATGACGGTAATATATCAATTTGGGGTATAGGAGATGGTTACCAAGCTAAAAAACCTT
TCTTTTTGTTTAAATCTCACCCTAATGGAAATGAGTTAATTGAAGATATTTGTTGGAATG
CTGAGGGAAATATGTTGATAGCAACTACATTAAAAAAGTATGTGTTTTTAGCTTTATTTG
GAGAAACTGTATTTGGGTCTAAACTAAGCCCTCAATAAAAGTAAGATTTTTTGGAAGGAA
AATATGGAACATTGAGAACTGTAGCAGCCACAAATATGAAGTTTAAAGTATTTAAAGCAA
CATAGTAAGAAGAGGAAGAGGAATAAAAAAATAAAGAAAAGCAACTCTTTGAAGCTAAAG
GTGATAATAAATAAATTGATTCTATCCTTGGAAGAGGAAATAACAATGGCAAAACAGCTA
CTTAATTTGGAAGTTCAAATAGCACAAATTAAAATGCTGATTAAAATTAAGAAGTTTTAA
CAAGTATCTCATATACAGAGCAAAAGACTCTAAATGAAGGAGGGAAAAAAAGAATTATTC
CTAGCAAGTAAATCATATCTAAAGTTGTTGTTGAAAAGAAAGTAATTTATTACTTTATTT
AATATTTAACTAACTTAAATATAAAATTAGCCAGAAGAAGAACAAAAAAGTAACGAAAAT
AATAAAATGATAGAGGAAAAGCCATTAGAGAATAATTAAAATATACCAAAAGCAGATAAT
TAAATTGATGTTAAAAGTTAAACATAATAAAGCAGTTCGATATAAGAAAAAGAATCTAAT
ATTGAAGAAGGTAAGGTAAAACCAATAGATACCAATGATAGCAAGAAAATGGAAATAGAA
ACTATTCCTGTTCCTTCCAATTAAAATTAAATTAATAATAAAGATGAAAGTAAAAAAATG
GAAGAAGAAAAGAAGCCTTCCTAGCCAACTAGTTAAAATAACACAAATTAAACTGCTGTT
CAAAATTAGACAAACCTGAGTACAACCGTTAAGAGCATAGATCATGCTAAAAAAGACTTA
AAAGATCCTAAAAAATCTTTATAAAAAACAAATGTTGTACCATCTGTCACAGGTTCAAGC
ACATAAGGAGGATCAAATGCAAATTAATCCAAAGACCAATAAAGCAAAAATATTGAAAAC
GCTCAATTCATTGAAGAATAAGAAAAATTATAAGAAACTGTGAAACTTAAAGTTCCTTAA
CCCATTCCAAATATACATACAATGCGTATTTCATAAGCTGAAATTAAATTTTTGGAAATT
GAAACACCTTAAAATTAACTGAATGCTCCATTAACCACATAAATTCGTTGCACAATCTTA
AAAAATAATGCTAAAGAGATATTATGGAATGACTGTATAGAAGGAAAGCTACTTTTTGTA
GAAATATATAATGATTAATTAATTTACTACACATCTTCACACTTGCTGTATTTCGTAAAT
TCATTAAATGGAAGAAGAAGTGAACTTCCTTTGTTAATTCCAAATATTTGCTGGTTAAAA
TTAAATAAGTCTAACTAAATGATGAGTCTTTCTGAAAATGGTGATGTTAAAGTCTATGAC
AATAATATTAAAAAACTTATAATAAACGAGAATATTATGTTCCTATTAAAAGAAAATCTA
AAAATGTTATCTTAGAATTAAGATTTACCAGACTCAGGTTCAAAAGATCCAATAGAAAAT
GTAACACTGGATAATAATGGAGTACCAATAATTTTCTTTAAGACTAGGAATGTTTATATT
TTTAATGTTCCAATGAAAACTTGGCAAAAAATAGACAACTTTAATATAGAAATAGGTATT
AAAATCTTATTTTAAATATTTAAACTAATTTTTATTATTGTAAAAATAATAAGGGTGCTT
TTATGATGCAAGTTAACTCTTATCAAAAGATAATAAAGGAGATAGTAGCGTTGCTGCTAT
CAAAGAGGCTGAAGACTTGGGCTAATTCTTTGAAAAGTTAATAGAAGTGAGCCCTGGAGA
GCTTGAACTAGAAAACAGAAAAGATGTTAGCATAGTTTCTAAATATGAAGAAAGATTAAT
TTATCTAATGAAATATGATGAAAAAAAGAGCTCAGATGTATTCATTGAAACTACTTCAAA
GTATATTAAAAAATTATGCGATTTAAGGGAATTTAATAAAATAAGATAATTCATAGCTGA
CTTCTTCTGCAACACAAATACTTAAGAGTATTAGTTTATGAAGAAAAATAACATTGACTC
AACAAAGCTATTTAAAAATATAAAAAGAATACTTGACTATTTCCCTTATACAAGTGATTT
ATCTTCTGAAATAGAAGAAATCATTTAATTTAAAGGAAAATCTAATTGA