Identifiers and Description

Gene Model Identifier

TTHERM_01123840

Standard Name

HIB1 (HydroxyIsoButyrate dehydrogenase)

Aliases

PreTt03038 | 244.m00024 | 3834.m00386

Description

3-hydroxyisobutyrate dehydrogenase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • phosphogluconate dehydrogenase (decarboxylating) activity (IEA) | GO:0004616

Biological Process

Domains

  • ( PF02254 ) TrkA-N domain
  • ( TIGR00745 ) 2-dehydropantoate 2-reductase
  • ( TIGR03026 ) nucleotide sugar dehydrogenase
  • ( TIGR00112 ) pyrroline-5-carboxylate reductase
  • ( TIGR01692 ) 3-hydroxyisobutyrate dehydrogenase
  • ( TIGR01505 ) 2-hydroxy-3-oxopropionate reductase
  • ( PF03807 ) NADP oxidoreductase coenzyme F420-dependent
  • ( PF00107 ) oxidoreductase, zinc-binding dehydrogenase family
  • ( TIGR00872 ) 6-phosphogluconate dehydrogenase (decarboxylating)
  • ( PF03446 ) NAD binding domain of 6-phosphogluconate

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.6%

TetraMine Data

TTHERM_01123840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15858.19.997093137033517e-2623-hydroxyisobutyrate dehydroge
nase (317 aa)
DictyBaseDDB_G02925662.0005330067840427e-93hibA on chromosome: 6 position
1891263 to 1892228
OxytrichaContig18515.0.g309.996584278131743e-91NAD binding domain of 6-phosph
ogluconate dehydrogenase
WormBaseWBGene000071229.999030951775615e-88Probable 3-hydroxyisobutyrate
dehydrogenase, mitochondrial
status:Confirmed UniProt:Q9
XTI0 protein_id:CAB03798.1
Stentor CoeruleusSteCoe_3860.0000000000002543665647376923
SGDYGR256W0.000030009396760408108GND2 6-phosphogluconate dehydr
ogenase (decarboxylating), cat
alyzes an NADPH regenerating r
eaction in the pentose phospha
te pathway; required for growt
h on D-glucono-delta-lactone

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01123840(coding)
ATGAGAAGAATCGCTCGTTCCTTAAATAACTCCTAATATCTCAGAGCAGAAACTGTTGGT
TTCATCGGTTTGGGAAATATGGGTGGCCCTATGGCTCTTAATTTAGCTAGAAAAGGTGGC
TTTGAAGTTATTGCTTTTGATGTAAATAAAGATTCTTTGAAGAAATATGCTAAAGAAGGT
TTAGCTGTTTGTGAAGATGTTACAGTATTGGCACGTAAAGCTAACAAGTTCGTTACAATG
CTTCCTAACTCTTCCCATGTTAGCAGTGTCTTAGAAGGGGAAAATGGATTATTCTAAAAG
AGTGCAAAAAATAGTTTGTTTATTGATTCATCTACAATTTCTTATCATGCTGCTATAAAG
ATCTACGAAAATGCTAAGAAGGTCAATCAACGTTACATTGATGCTCCTGTTAGTGGTGGT
GTTGGTGCTGCAACAGCTGGTACTCTCACTTTTATGGTTGGTGCTGAAAATAAGGAACTC
TTCTAAGAATGCAAAAATCTTCTTTAACACATGGGTAAAAATATCGCCAACTGTGAAAAA
CCTGGTGCTGGATCTATTGCTAAAATTTGCAATAACATGGCTCTTGGTATTGAAATGATA
GCCGTTGCAGAAGCTATCTCCTTGGGCAAAAAGCTTGGTATCGACCCTAAAGTTCTTTCA
TCAATCATGAATACTGCATCTGGTAGATGCTGGAGTAGTGAAGTCTATAACCCTTGCCCT
GGCGTATTAGAAAATGTTCCTGCTTCTAAGGGTTATGAAGGAGGTTTTGCTTGTGAACTT
ATGCTTAAGGATTTAGGATTAGCTGCTGATGCTGCAAAACAAGCTTCTGCTGATGTTCCT
CTTGGTAACCATGCAAAAGATATTTACTAAAAATTGGTTGAATTGGGACTTAATCGTAAA
GATTTTGCTATCGTTTATGATGTCCTCTTAAATAATAAACTTAAATAATGA


>TTHERM_01123840(protein)
MRRIARSLNNSQYLRAETVGFIGLGNMGGPMALNLARKGGFEVIAFDVNKDSLKKYAKEG
LAVCEDVTVLARKANKFVTMLPNSSHVSSVLEGENGLFQKSAKNSLFIDSSTISYHAAIK
IYENAKKVNQRYIDAPVSGGVGAATAGTLTFMVGAENKELFQECKNLLQHMGKNIANCEK
PGAGSIAKICNNMALGIEMIAVAEAISLGKKLGIDPKVLSSIMNTASGRCWSSEVYNPCP
GVLENVPASKGYEGGFACELMLKDLGLAADAAKQASADVPLGNHAKDIYQKLVELGLNRK
DFAIVYDVLLNNKLKQ


>TTHERM_01123840(gene)
ATGAGAAGAATCGCTCGTTCCTTAAATAACTCCTAATATCTCAGAGCAGAAACTGTTGGT
TTCATCGGTTTGGGAAATATGGGTGGCCCTATGGCTCTTAATTTAGCTAGAAAAGGTGGC
TTTGAAGTTATTGCTTTTGATGTAAATAAAGATTCTTTGAAGAAATATGCTAAAGAAGGT
TTAGCTGTTTGTGAAGATGTTACAGTATTGGCACGTAAAGCTAACAAGTTCGTTACAATG
CTTCCTAACTCTTCCCATGTTAGCAGTGTCTTAGAAGGGGAAAATGGATTATTCTAAAAG
AGTGCAAAAAATAGTTTGTTTATTGATTCATCTACAATTTCTTATCATGCTGCTATAAAG
ATCTACGAAAATGCTAAGAAGGTCAATCAACGTTACATTGATGCTCCTGTTAGTGGTGGT
GTTGGTGCTGCAACAGCTGGTACTCTCACTTTTATGGTTGGTGCTGAAAATAAGGAACTC
TTCTAAGAATGCAAAAATCTTCTTTAACACATGGGTAAAAATATCGCCAACTGTGAAAAA
CCTGGTGCTGGATCTATTGCTAAAATTTGCAATAACATGGCTCTTGGTATTGAAATGATA
GCCGTTGCAGAAGCTATCTCCTTGGGCAAAAAGCTTGGTATCGACCCTAAAGTAAACAAT
TTTATATTTATATTAGTCATTAAAATATTCTAAAAGACATAAATAAAATTATTAGTAGAA
CAAATATTATGAGAATTAAATTATGCTATCATTTTCAATCAAAAAAATTATTTTTTTTAA
AAAACTGTTATAAATAAATATATTTTTTGTCTTTTTATTTATTTATTTATTAATTTCCAT
TTTTAAAATAAATAAACTAATAAATAATAAAATAGGTTCTTTCATCAATCATGAATACTG
CATCTGGTAGATGCTGGAGTAGTGAAGTCTATAACCCTTGCCCTGGCGTATTAGAAAATG
TTCCTGCTTCTAAGGGTTATGAAGGAGGTTTTGCTTGTGAACTTATGCTTAAGGATTTAG
GATTAGCTGCTGATGCTGCAAAACAAGCTTCTGCTGATGTTCCTCTTGGTAACCATGCAA
AAGATATTTACTAAAAATTGGTTGAATTGGGACTTAATCGTAAAGATTTTGCTATCGTTT
ATGATGTCCTCTTAAATAATAAACTTAAATAATGA