Identifiers and Description

Gene Model Identifier

TTHERM_00648920

Standard Name

HIAP1 (Histone-interacting acidic protein 1)

Aliases

PreTt09206 | 94.m00124 | 3677.m00032

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00648920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17846.13.998052787723392e-80hypothetical protein (277 aa)

General Information

Paragraph NoGene NameParagraph Text
130HIAP1HIAP1 was identified as a high-confidence interacting partner of histones H2A/H2B and Hv1 in affinity purification followed by mass spectrometry experiments. HIAP1 shares sequence similarity with nucleoplasmin 1 (CNPL1 in Tetrahymena) due to stretches of acidic residues

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00648920(coding)
ATGTTTTGGGGAGCTTAAGTTCAGTTTAATCAAAAGTTTGTTCCAGAAAAGGAAGACTAT
GCTTATCTTCATTTAAGAAATGTTAGCACTTTATGGGCAAATGAAAAAATTAGCTTGGTT
TGCAATATTAAGAAGCAAGAAAACGGAGTCGAAGAAGAAATTGATATTGTTTTATGCCAT
TTAGATGAAAATAAAAATAGAAGTGCTCAGTTAAATCTTTACTTTGATTTAAAAAATTAA
GATATCAGCTTCAGTGTTATCGGAAAAGGAAGAGTCTGCTTGATGGGCTCTCTTGAGGCT
AAAGAGGGTAAGGCTCTCACAAACGAACTTGTAAAGAATTTAGGACCACAAATTGCTGAT
GCTAAAAAGAAAATGATTCTTGAGTTAGCAGGTCTTGTAAAAGATATGAAATAAAAAGGT
GGAAATCAAGAAGATGACGATGAGGATTTAGATGATGAAGAAGAATATGTAGAGGGTATG
GATCTTGAAAGTGATGATGAAGATGGTGAAGAAGATAACGAAGATGAAGAGGAAGTAGAA
AGTGAAATTAGTGATTAAGAAAATTAAATAGTAGAATAAAAAAAATCCTAATAAAGTCAA
AATCAATAAAAGAATAATAACAATAAAAATAATAAGTAAGCAAATAATTAGAACATTGGC
AAGAAGCCTATTTAAAACAAACCTGCTTAAAACTAAAATTAACAACAAAAGCAAAATAAA
TAGGAAAACAAAAATCAATAATAAAAAAACAATGGTTAGAATAAATAGTAAAATGGTAAG
AAAGGTGAATTCCAAATCACTTATAACTACAAACCTAAAAAGGAAGAAGAAATAGAAAAA
GACGAATTTGCTGCAATTTGA


>TTHERM_00648920(protein)
MFWGAQVQFNQKFVPEKEDYAYLHLRNVSTLWANEKISLVCNIKKQENGVEEEIDIVLCH
LDENKNRSAQLNLYFDLKNQDISFSVIGKGRVCLMGSLEAKEGKALTNELVKNLGPQIAD
AKKKMILELAGLVKDMKQKGGNQEDDDEDLDDEEEYVEGMDLESDDEDGEEDNEDEEEVE
SEISDQENQIVEQKKSQQSQNQQKNNNNKNNKQANNQNIGKKPIQNKPAQNQNQQQKQNK
QENKNQQQKNNGQNKQQNGKKGEFQITYNYKPKKEEEIEKDEFAAI


>TTHERM_00648920(gene)
ATGTTTTGGGGAGCTTAAGTTCAGTTTAATCAAAAGTTTGTTCCAGAAAAGGAAGACTAT
GCTTATCTTCATTTAAGAAATGTTAGCACTTTATGGGCAAATGAAAAAATTAGCTTGGTT
TGCAATATTAAGAAGCAAGAAAACGGAGTCGAAGAAGAAATTGATATTGTTTTATGCCAT
TTAGATGAAAATAAAAATAGAAGTGCTCAGTTAAATCTTTACTTTGATTTAAAAAATTAA
GATATCAGCTTCAGTGTTATCGGAAAAGGAAGAGTCTGCTTGATGGGCTCTCTTGAGGCT
AAAGAGGGTAAGGCTCTCACAAACGAACTTGTAAAGAATTTAGGACCACAAATTGCTGAT
GCTAAAAAGAAAATGATTCTTGAGTTAGCAGGTCTTGTAAAAGATATGAAATAAAAAGGT
GGAAATCAAGAAGATGACGATGAGGATTTAGATGATGAAGAAGAATATGTAGAGGGTATG
GATCTTGAAAGTGATGATGAAGATGGTGAAGAAGATAACGAAGATGAAGAGGAAGTAGAA
AGTGAAATTAGTGATTAAGAAAATTAAATAGTAGAATAAAAAAAATCCTAATAAAGTCAA
AATCAATAAAAGAATAATAACAATAAAAATAATAAGTAAGCAAATAATTAGAACATTGGC
AAGAAGCCTATTTAAAACAAACCTGCTTAAAACTAAAATTAACAACAAAAGCAAAATAAA
TAGGAAAACAAAAATCAATAATAAAAAAACAATGGTTAGAATAAATAGTAAAATGGTAAG
AAAGGTGAATTCCAAATCACTTATAACTACAAACCTAAAAAGGAAGAAGAAATAGAAAAA
GACGAATTTGCTGCAATTTGA