Identifiers and Description

Gene Model Identifier

TTHERM_00016200

Standard Name

HHT4 (Histone H Three)

Aliases

PreTt11927 | 1.m00975

Description

histone H3.3, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00016200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02628.19.998285701479858e-93histone H3 (137 aa)
WormBaseWBGene000018874.001371804839974e-78locus:his-13 Histone H3 st
atus:Predicted UniProt:P0889
8 protein_id:CAB05834.1
OxytrichaContig1081.1.g601.9998099689916736e-77Core histone H2A/H2B/H3/H4
DictyBaseDDB_G02674022.9990539278805726e-74H3a on chromosome: 1 position
1520754 to 1521173
SGDYNL031C5.001369568193564e-73HHT2 Histone H3, core histone
protein required for chromatin
assembly, part of heterochrom
atin-mediated telomeric and HM
silencing; one of two identic
al histone H3 proteins (see HH
T1); regulated by acetylation,
methylation, and phosphorylat
ion
Stentor CoeruleusSteCoe_179487.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16908532: Cui B, Liu Y, Gorovsky MA (2006) Deposition and function of histone H3 variants in Tetrahymena thermophila. Molecular and cellular biology 26(20):7719-30

Sequences

>TTHERM_00016200(coding)
ATGGCTAGAACTAAATAAACTGCTAGAAAGTCAACTAGTATTAAGGCTCCTAGAAAACAA
TTGGCTGCCAAGGCTGCCAGAAAGTCTGCCCCCATCTCTGGTGGTATCAAAAAGCCCCAT
AAATTCAGACCTGGTACCGTTGCCTTGAGAGAAATCAGAAAGTATTAAAAGACTACTGAC
TTACTTATTAGAAAGCTCCCCTTCTAAAGACTTGTCAGAGATATTGCTATGGAAATGAAG
AGCGATATCAGATTCCAATCACAAGCTATCCTTGCCCTCCAAGAAGCTGCTGAAGCCTAC
CTAGTAGGTTTATTCGAAGATACCAACCTCTGCGCTATCCACGCTAGAAGAGTTACTATT
ATGACCAAGGATCTCCACCTTGCTAGAAGAATTAGAGGAGAAAGATTCTGA


>TTHERM_00016200(protein)
MARTKQTARKSTSIKAPRKQLAAKAARKSAPISGGIKKPHKFRPGTVALREIRKYQKTTD
LLIRKLPFQRLVRDIAMEMKSDIRFQSQAILALQEAAEAYLVGLFEDTNLCAIHARRVTI
MTKDLHLARRIRGERF


>TTHERM_00016200(gene)
ATGGCTAGAACTAAATAAACTGCTAGAAAGTCAACTAGTATTAAGGCTCCTAGAAAACAA
TTGGCTGCCAAGGCTGCCAGAAAGTCTGCCCCCATCTCTGGTGGTATCAAAAAGCCCCAT
AAATTCAGACCTGGTACCGTTGCCTTGAGAGAAATCAGAAAGTATTAAAAGACTACTGAC
TTACTTATTAGAAAGCTCCCCTTCTAAAGACTTGTCAGAGATATTGCTATGGAAATGAAG
AGCGATATCAGATTCCAATCACAAGCTATCCTTGCCCTCCAAGAAGCTGCTGAAGCCTAC
CTAGTAGGTTTATTCGAAGATACCAACCTCTGCGCTATCCACGCTAGAAGAGTTACTATT
ATGACCAAGGATCTCCACCTTGCTAGAAGAATTAGAGGAGAAAGATTCTGA