Identifiers and Description
Gene Model Identifier
TTHERM_00016170Standard Name
HHT3 (Histone H Three)Aliases
PreTt11924 | 1.m00972Description
Histone minor H3 variant, H3.3; replication independent replacement variant found primarily in macronuclei; constitutively expressed; not essential for cell growthGenome Browser
![]()
Gene Ontology Annotations
Cellular Component
- macronucleus (TAS) | GO:0031039 | Ref:8760889
- micronucleus (IDA) | GO:0031040 | Ref:16908532
Domains
- ( PF00125 ) Core histone H2A/H2B/H3/H4
Gene Expression Profile
- Tetrahymena Functional Genomics Database: TTHERM_00016170
Homologs (v.2006 protein sequences)
Source Identifier Score Description IPI(HUMAN) IPI:IPI00719351.2 6.00092892288903e-46 Tax_Id=9606 PREDICTED: similar
to H3 histone, family 2 isofo
rm 2
ToxoDB 55.m00013 1.99968328947091e-41 Toxoplasma gondii histone H3
TAIR AT1G09200 3.99877799324454e-41 histone H3
TAIR AT3G27360 3.99877799324454e-41 histone H3
TAIR AT5G65360 3.99877799324454e-41 histone H3
TAIR AT5G10390 3.99877799324454e-41 histone H3
TAIR AT5G10400 3.99877799324454e-41 histone H3
PlasmoDB PFF0865w 1.00040380126762e-40 Plasmodium falciparum PFF0865w
WormBase Y49E10.6 1.00040380126762e-40 WBGene00001946 his-72 Core his
tone H2A/H2B/H3/H4
WormBase F45E1.6 1.00040380126762e-40 WBGene00001945 his-71 Histone
H3
CryptoDB EAK87921 9.9981864321491e-40 Cryptosporidium parvum (Iowa)
protein EAK87921
DictyBase DDB0202045 1.99934300035144e-39 nek2 NEK family protein kinase
protein serine/threonine kina
se
ParameciumDB GSPATP00018066001 2.00017271388466e-38 Paramecium tetraurelia GSPATP0
0018066001 protein
SGD YNL031C 1.99983234147913e-36 HHT2 SGDID:S000004976, Chr XIV
from 576051-575641, reverse c
omplement, Verified ORF, "One
of two identical histone H3 pr
oteins (see also HHT1); core h
istone required for chromatin
assembly, involved in heteroch
romatin-mediated telomeric and
HM silencing; regulated by ac
etylation, methylation, and mi
totic phosphorylation"
SGD YBR010W 1.99983234147913e-36 HHT1 SGDID:S000000214, Chr II
from 256329-256739, Verified O
RF, "One of two identical hist
one H3 proteins (see also HHT2
); core histone required for c
hromatin assembly, involved in
heterochromatin-mediated telo
meric and HM silencing; regula
ted by acetylation, methylatio
n, and mitotic phosphorylation
"
General Information
No Data fetched for General Information
Associated Literature
- Ref:16908532: Cui B, Liu Y, Gorovsky MA (2006) Deposition and function of histone H3 variants in Tetrahymena thermophila. Molecular and cellular biology 26(20):7719-30
- Ref:15196465: Mochizuki K, Gorovsky MA (2004) Small RNAs in genome rearrangement in Tetrahymena. Current opinion in genetics & development 14(2):181-7
- Ref:14755052: Liu Y, Mochizuki K, Gorovsky MA (2004) Histone H3 lysine 9 methylation is required for DNA elimination in developing macronuclei in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 101(6):1679-84
- Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
- Ref:12522258: Zilberman D, Cao X, Jacobsen SE (2003) ARGONAUTE4 control of locus-specific siRNA accumulation and DNA and histone methylation. Science (New York, N.Y.) 299(5607):716-9
- Ref:14661947: Poux AN, Marmorstein R (2003) Molecular basis for Gcn5/PCAF histone acetyltransferase selectivity for histone and nonhistone substrates. Biochemistry 42(49):14366-74
- Ref:14536085: Clements A, Poux AN, Lo WS, Pillus L, Berger SL, Marmorstein R (2003) Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase. Molecular cell 12(2):461-73
- Ref:11891286: Shang Y, Song X, Bowen J, Corstanje R, Gao Y, Gaertig J, Gorovsky MA (2002) A robust inducible-repressible promoter greatly facilitates gene knockouts, conditional expression, and overexpression of homologous and heterologous genes in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 99(6):3734-9
- Ref:12455963: Duharcourt S, Yao MC (2002) Role of histone deacetylation in developmentally programmed DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 1(2):293-303
- Ref:11972045: Dou Y, Gorovsky MA (2002) Regulation of transcription by H1 phosphorylation in Tetrahymena is position independent and requires clustered sites. Proceedings of the National Academy of Sciences of the United States of America 99(9):6142-6
- Ref:12123289: Waterborg JH (2002) Dynamics of histone acetylation in vivo. A function for acetylation turnover? Biochemistry and cell biology = Biochimie et biologie cellulaire 80(3):363-78
- Ref:12297044: Taverna SD, Coyne RS, Allis CD (2002) Methylation of histone h3 at lysine 9 targets programmed DNA elimination in tetrahymena. Cell 110(6):701-11
- Ref:12351775: Jenuwein T (2002) Molecular biology. An RNA-guided pathway for the epigenome. Science (New York, N.Y.) 297(5590):2215-8
- Ref:11994311: Langer MR, Fry CJ, Peterson CL, Denu JM (2002) Modulating acetyl-CoA binding in the GCN5 family of histone acetyltransferases. The Journal of biological chemistry 277(30):27337-44
- Ref:11784863: Crosio C, Fimia GM, Loury R, Kimura M, Okano Y, Zhou H, Sen S, Allis CD, Sassone-Corsi P (2002) Mitotic phosphorylation of histone H3: spatio-temporal regulation by mammalian Aurora kinases. Molecular and cellular biology 22(3):874-85
- Ref:11751634: Briggs SD, Bryk M, Strahl BD, Cheung WL, Davie JK, Dent SY, Winston F, Allis CD (2001) Histone H3 lysine 4 methylation is mediated by Set1 and required for cell growth and rDNA silencing in Saccharomyces cerevisiae. Genes & development 15(24):3286-95
- Ref:11135657: Tan S (2001) One HAT size fits all? Nature structural biology 8(1):8-10
- Ref:11467741: Green GR (2001) Phosphorylation of histone variant regions in chromatin: unlocking the linker? Biochemistry and cell biology = Biochimie et biologie cellulaire 79(3):275-87
- Ref:11112280: Trievel RC, Li FY, Marmorstein R (2000) Application of a fluorescent histone acetyltransferase assay to probe the substrate specificity of the human p300/CBP-associated factor. Analytical biochemistry 287(2):319-28
- Ref:10503205: Wiley EA, Mizzen CA, Allis CD (2000) Isolation and characterization of in vivo modified histones and an activity gel assay for identification of histone acetyltransferases. Methods in cell biology 62( ):379-94
- Ref:10975520: De Souza CP, Osmani AH, Wu LP, Spotts JL, Osmani SA (2000) Mitotic histone H3 phosphorylation by the NIMA kinase in Aspergillus nidulans. Cell 102(3):293-302
- Ref:10975519: Hsu JY, Sun ZW, Li X, Reuben M, Tatchell K, Bishop DK, Grushcow JM, Brame CJ, Caldwell JA, Hunt DF, Lin R, Smith MM, Allis CD (2000) Mitotic phosphorylation of histone H3 is governed by Ipl1/aurora kinase and Glc7/PP1 phosphatase in budding yeast and nematodes. Cell 102(3):279-91
- Ref:10549296: Dou Y, Mizzen CA, Abrams M, Allis CD, Gorovsky MA (1999) Phosphorylation of linker histone H1 regulates gene expression in vivo by mimicking H1 removal. Molecular cell 4(4):641-7
- Ref:10611321: Strahl BD, Ohba R, Cook RG, Allis CD (1999) Methylation of histone H3 at lysine 4 is highly conserved and correlates with transcriptionally active nuclei in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 96(26):14967-72
- Ref:10551870: Karrer KM, VanNuland TA (1999) Nucleosome positioning is independent of histone H1 in vivo. The Journal of biological chemistry 274(46):33020-4
- Ref:10536141: Hettmann C, Soldati D (1999) Cloning and analysis of a Toxoplasma gondii histone acetyltransferase: a novel chromatin remodelling factor in Apicomplexan parasites. Nucleic acids research 27(22):4344-52
- Ref:10199406: Wei Y, Yu L, Bowen J, Gorovsky MA, Allis CD (1999) Phosphorylation of histone H3 is required for proper chromosome condensation and segregation. Cell 97(1):99-109
- Ref:9343391: Yu L, Gorovsky MA (1997) Constitutive expression, not a particular primary sequence, is the important feature of the H3 replacement variant hv2 in Tetrahymena thermophila. Molecular and cellular biology 17(11):6303-10
- Ref:8121802: Thatcher TH, MacGaffey J, Bowen J, Horowitz S, Shapiro DL, Gorovsky MA (1994) Independent evolutionary origin of histone H3.3-like variants of animals and Tetrahymena. Nucleic acids research 22(2):180-6
Sequences
>TTHERM_00016170(coding)
ATGGCTAGAACTAAATAAACTGCTAGAAAGTCAACTGGTGTTAAGGCTCCTAGAAAACAA
CTCGCTACCAAGGCTGCCAGAAAGTCTGCCCCCGTCTCTGGTGGTGTCAAGAAGCCCCAT
AAATTCAGACCTGGTACCGTCGCCTTGAGAGAAATCAGAAAGTATTAAAAGACTACTGAC
TTACTTATTAGAAAGCTCCCCTTCTAAAGACTTGTCAGAGATATTGCTATGGAAATGAAG
AGTGATATCAGATTCCAATCCCAAGCTATCCTTGCCCTCCAAGAAGCCGCTGAAGCCTAC
CTCGTCGGTTTATTCGAAGATACCAACCTCTGCGCTATCCACGCTAGAAGAGTTACTATT
ATGACCAAGGATCTCCACCTTGCTAGAAGAATTAGAGGAGAAAGATTCTGA>TTHERM_00016170(protein)
MARTKQTARKSTGVKAPRKQLATKAARKSAPVSGGVKKPHKFRPGTVALREIRKYQKTTD
LLIRKLPFQRLVRDIAMEMKSDIRFQSQAILALQEAAEAYLVGLFEDTNLCAIHARRVTI
MTKDLHLARRIRGERF>TTHERM_00016170(gene)
TTAAATTAAAAAAAAATTTAATCAAAAAAAAAAACCTCAAAGTTTTTTGAAAAAAGCAAT
TAAAAAAATAATTTTCACACAAAACAGTAACAAAAATGGCTAGAACTAAATAAACTGCTA
GAAAGTCAACTGGTGTTAAGGCTCCTAGAAAACAACTCGCTACCAAGGCTGCCAGAAAGT
CTGCCCCCGTCTCTGGTGGTGTCAAGAAGCCCCATAAATTCAGACCTGGTACCGTCGCCT
TGAGAGAAATCAGAAAGTATTAAAAGACTACTGACTTACTTATTAGAAAGCTCCCCTTCT
AAAGACTTGTCAGAGATATTGCTATGGAAATGAAGAGTGATATCAGATTCCAATCCCAAG
CTATCCTTGCCCTCCAAGAAGCCGCTGAAGCCTACCTCGTCGGTTTATTCGAAGATACCA
ACCTCTGCGCTATCCACGCTAGAAGAGTTACTATTATGACCAAGGATCTCCACCTTGCTA
GAAGAATTAGAGGAGAAAGATTCTGAGAGCTCTCTCTAATAATTAACTTAATATATAATA
CACACATATAATATAATGTTTTCTTATTATGGGAATGCAGCTTGCATCTTGATGCTTTTT
ACTCTCTTTGATTATAAATAAACTTCATTGATTCATACGGATACATAAAATCATACTCTA
TATCAAGTACTTTATTCACTCATTCATTGATGAGTGAGTGAATGAATGAAAAAACATGGG
TGGTTGATTAACTTATTAATTAATTTAATATAAAGACTGCATATATGCCAATCAACATGC
ATACATGCATGAAATGTAATTAATTGGTCCTGACAAATAAATTATGTATAAATAAATAAA
TAAAACTATTAAAACGCATTGAGCCAAAAACAGCTTGCATACTGCATCTTCCAATTACTT
GTTTCATACACTCTTATATAAATTTAAATTAGTGGTATCAAATCACATAAAATATATATA
AATATATATTATGTATAATCTTAATTTTATTGCTAATCATCTCTTTCAATTGAAAAAGCT
TATCCAAAAAATTC