Identifiers and Description

Gene Model Identifier

TTHERM_00189180

Standard Name

HHT2 (Histone H Three)

Aliases

PreTt08668 | 15.m00379 | 3697.m00091

Description

Histone H3; one of the four histones (H2A, H2B, H3 and H4) that comprise the protein core of the eukaryotic nucleosome; lysine-9 methylated in heterochromatin; encoded protein identical to Hht1p; upregulated in HHT3 knockouts

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00189180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06290.16.997716170296885e-95hypothetical protein (137 aa)
OxytrichaContig1081.1.g602.0008312485874125e-83Core histone H2A/H2B/H3/H4
WormBaseWBGene000018875.000624069301489e-83locus:his-13 Histone H3 st
atus:Predicted UniProt:P0889
8 protein_id:CAB05834.1
SGDYNL031C5.999266750653237e-78HHT2 Histone H3, core histone
protein required for chromatin
assembly, part of heterochrom
atin-mediated telomeric and HM
silencing; one of two identic
al histone H3 proteins (see HH
T1); regulated by acetylation,
methylation, and phosphorylat
ion
DictyBaseDDB_G02708382.999564368270328e-76H3b on chromosome: 1 position
4846006 to 4846565
Stentor CoeruleusSteCoe_179484.906094730649281e-35

General Information

Paragraph NoGene NameParagraph Text
2TWI1,
HHT2,
PDD1,
PDD3,
DCL1
A proposed model for the mechanism of programmed DNA elimination in Tetrahymena is based on the timing of expression, cellular distribution, mutant phenotypes, and predicted functions of the protein and RNA components involved. In this model, both strands of the micronuclear genome (or perhaps only the portions containing internal eliminated sequences) are transcribed early in conjugation to produce large non-genic, double-stranded RNAs. This transcription is likely performed by RNA Polymerase II, based on the localization of its subunit Rpb3p to the micronucleus during this time. These transcripts pass to the cytoplasm where they are processed into short (~28 nucleotide) scan RNAs (scnRNA) by the dicer-like protein Dcl1p, similar to the production of the small inhibitory RNAs (siRNA) central to the RNA interference (RNAi) pathway of other eukaryotes. The scnRNAs complex with Twi1p, a member of the PPD (PAZ and Piwi Domain) protein family, whose members are commonly involved in RNAi and related processes. The scnRNA/Twi1p complexes enter the old macronucleus, where scnRNAs homologous to DNA sequences found there are degraded. The remaining scnRNAs, comprised of micronuclear-restricted sequences, are transferred to the developing macronucleus. There, histone H3 proteins (Hht1p, Hht2p) that are bound to sections of the genome sharing identity to the scnRNAs are methylated on lysine-9. This modification, which is often associated with the formation of heterochromatin, is recognized by one or more of the chromodomains belonging to Pdd1p and Pdd3p. Regions of DNA associated with these modified histones are eliminated from the developing macronuclear genome.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00189180(coding)
ATGGCTAGAACTAAATAAACTGCTAGAAAGTCCACTGGTGCTAAGGCCCCCAGAAAATAA
CTCGCTTCCAAGGCCGCCAGAAAGTCTGCCCCCGCCACTGGTGGTATCAAGAAGCCCCAC
AGATTCAGACCTGGTACCGTCGCTCTCAGAGAAATCAGAAAGTACCAAAAGTCCACTGAT
TTGTTGATCAGAAAGCTCCCCTTCTAAAGATTGGTCAGAGATATTGCTCACGAATTCAAG
GCTGAACTCAGATTCTAATCTTCTGCCGTTCTTGCTCTCCAAGAAGCTGCTGAAGCTTAC
CTCGTCGGTCTCTTCGAAGATACCAACTTGTGCGCTATCCACGCTAGAAGAGTTACTATT
ATGACCAAGGATATGCAACTCGCTAGAAGAATTAGAGGTGAAAGATTCTGA


>TTHERM_00189180(protein)
MARTKQTARKSTGAKAPRKQLASKAARKSAPATGGIKKPHRFRPGTVALREIRKYQKSTD
LLIRKLPFQRLVRDIAHEFKAELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTI
MTKDMQLARRIRGERF


>TTHERM_00189180(gene)
ATGGCTAGAACTAAATAAACTGCTAGAAAGTCCACTGGTGCTAAGGCCCCCAGAAAATAA
CTCGCTTCCAAGGCCGCCAGAAAGTCTGCCCCCGCCACTGGTGGTATCAAGAAGCCCCAC
AGATTCAGACCTGGTACCGTCGCTCTCAGAGAAATCAGAAAGTACCAAAAGTCCACTGAT
TTGTTGATCAGAAAGCTCCCCTTCTAAAGATTGGTCAGAGATATTGCTCACGAATTCAAG
GCTGAACTCAGATTCTAATCTTCTGCCGTTCTTGCTCTCCAAGAAGCTGCTGAAGCTTAC
CTCGTCGGTCTCTTCGAAGATACCAACTTGTGCGCTATCCACGCTAGAAGAGTTACTATT
ATGACCAAGGATATGCAACTCGCTAGAAGAATTAGAGGTGAAAGATTCTGA