Identifiers and Description

Gene Model Identifier

TTHERM_00705240

Standard Name

HHP1 (H1/HP1-like )

Aliases

PreTt26879 | 111.m00100 | 3744.m00021

Description

HP1-like phosphoprotein; implicated in the establishment and/or maintenance of starvation-induced chromatin assembly and gene expression; localized to the macronucleus; contains a chromoshadow domain and a chromodomain; nonessential

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00705240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17724.11.9990449803848145e-49heterochromatin-associated pro
tein 1-like protein (178 aa)
WormBaseWBGene000004140.000000600201742947405locus:cec-1 Chromo domain-co
ntaining protein cec-1 statu
s:Confirmed UniProt:P34618
protein_id:CCD66162.1
OxytrichaContig9832.0.g370.0000007997233352734267Chromo (CHRromatin Organisatio
n MOdifier) domain
DictyBaseDDB_G02681340.000050024383570459175DDB_G0268134 on chromosome: 1
position 1521691 to 1526501

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10207086: Huang H, Smothers JF, Wiley EA, Allis CD (1999) A nonessential HP1-like protein affects starvation-induced assembly of condensed chromatin and gene expression in macronuclei of Tetrahymena thermophila. Molecular and cellular biology 19(5):3624-34
  2. Ref:9811850: Huang H, Wiley EA, Lending CR, Allis CD (1998) An HP1-like protein is missing from transcriptionally silent micronuclei of Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 95(23):13624-9

Sequences

>TTHERM_00705240(coding)
ATGACAAAAGTTTACGAAGTAGAAAATATTATAGGACATAGAAAAAAAGGAAGTTAGATT
GAATACCATATCTAATGGAAAGGCTACTCTCTCAAATAAGCTACTTATGAACCTGCTAAA
AATATTTTAGATAAGAATATGCTTAAAAAATACCAATAAAAGCATTTACTTAGCAATGAT
AAACCTTAGACACCCATTAAGAAATCAATTAAAAAAGGAGCTTCAACTCATTAAACACGT
AAATCTAGCTCAACTACTAAGAGAAGTGTTAAAAAATCAGTTGAAAAAGCATCTAATCCT
AAATCTACTCCTAAATTAGATAAAAAAGCATTAGATCCAGTGAAGGAAATTCATAATTAT
TAAAAGGATGTCAGTAAACTTCTTTTAAAGAGTGATATAACCTCCATATTGCACGTTTTT
AAGGATGATGGAAAATCTCTTTACACAGTCACAATTGGAAAACATCCTAAATAATATTTA
GTATCAAGTAGCTAAATTGCTAAGTATGCTTCTCCCGATCTCATAGTTAGATTCTATGAA
AAGCTAATCCGCTGA


>TTHERM_00705240(protein)
MTKVYEVENIIGHRKKGSQIEYHIQWKGYSLKQATYEPAKNILDKNMLKKYQQKHLLSND
KPQTPIKKSIKKGASTHQTRKSSSTTKRSVKKSVEKASNPKSTPKLDKKALDPVKEIHNY
QKDVSKLLLKSDITSILHVFKDDGKSLYTVTIGKHPKQYLVSSSQIAKYASPDLIVRFYE
KLIR


>TTHERM_00705240(gene)
ATGACAAAAGTTTACGAAGTAGAAAATATTATAGGACATAGAAAAAAAGGAAGTTAGATT
GAATACCATATCTAATGGAAAGGCTACTCTCTCAAATAAGCTACTTATGAACCTGCTAAA
AATATTTTAGATAAGAATATGCTTAAAAAATACCAATAGTAATCCCTTACAATTACATCA
ATTAATAAATCAACCATAATTTATTAATTAATATAAGCAAATGGTTGAATAATTTTTTTA
ACTTCAATTTTAATTATATTTAGAAAGCATTTACTTAGCAATGATAAACCTTAGACACCC
ATTAAGAAATCAATTAAAAAAGGAGCTTCAACTCATTAAACACGTAAATCTAGCTCAACT
ACTAAGAGAAGTGTTAAAAAATCAGTTGAAAAAGCATCTAATCCTAAATCTACTCCTAAA
TTAGATAAAAAAGCATTAGATCCAGTGTAAGAAATTTAAATAGAAATGAGCAAACAAACT
GTTATACTTAAAATTAAATTAATTTAAATAAATAGGAAGGAAATTCATAATTATTAAAAG
GATGTCAGTAAACTTCTTTTAAAGAGTGATATAACCTCCATATTGCACGTTTTTAAGGAT
GATGGAAAATCTCTTTACACAGTCACAATTGGAAAACATCCTAAATAATATTTAGTATCA
AGTAGCTAAATTGCTAAGTATGCTTCTCCCGATCTCATAGTTAGATTCTATGAAAAGCTA
ATCCGCTGA