Identifiers and Description

Gene Model Identifier

TTHERM_00498190

Standard Name

HHF1 (Histone H Four )

Aliases

PreTt06984 | 62.m00268 | 3715.m00129

Description

Histone H4; one of the four histones (H2A, H2B, H3 and H4) that comprise the protein core of the eukaryotic nucleosome; adjacent to HHT2; encoded protein identical to Hhf2p; expressed during macronuclear S-phase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF02583 ) Uncharacterized BCR, COG1937
  • ( PF02969 ) TATA box binding protein associated
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00498190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12656.17.999439018944131e-69histone H4, minor (104 aa)
OxytrichaContig10148.0.g409.995951036711152e-55Core histone H2A/H2B/H3/H4
WormBaseWBGene000018882.9986404383886433e-43locus:his-14 Histone H4 st
atus:Predicted UniProt:P6278
4 protein_id:CAB05839.1
SGDYNL030W7.997739975804982e-43HHF2 Histone H4, core histone
protein required for chromatin
assembly and chromosome funct
ion; one of two identical hist
one proteins (see also HHF1);
contributes to telomeric silen
cing; N-terminal domain involv
ed in maintaining genomic inte
grity
DictyBaseDDB_G02771836.001376218974307e-41H4a on chromosome: 2 position
7697697 to 7698023
Stentor CoeruleusSteCoe_36921.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14755052: Liu Y, Mochizuki K, Gorovsky MA (2004) Histone H3 lysine 9 methylation is required for DNA elimination in developing macronuclei in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 101(6):1679-84
  2. Ref:14536085: Clements A, Poux AN, Lo WS, Pillus L, Berger SL, Marmorstein R (2003) Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase. Molecular cell 12(2):461-73
  3. Ref:12522258: Zilberman D, Cao X, Jacobsen SE (2003) ARGONAUTE4 control of locus-specific siRNA accumulation and DNA and histone methylation. Science (New York, N.Y.) 299(5607):716-9
  4. Ref:14661947: Poux AN, Marmorstein R (2003) Molecular basis for Gcn5/PCAF histone acetyltransferase selectivity for histone and nonhistone substrates. Biochemistry 42(49):14366-74
  5. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
  6. Ref:12351775: Jenuwein T (2002) Molecular biology. An RNA-guided pathway for the epigenome. Science (New York, N.Y.) 297(5590):2215-8
  7. Ref:11784863: Crosio C, Fimia GM, Loury R, Kimura M, Okano Y, Zhou H, Sen S, Allis CD, Sassone-Corsi P (2002) Mitotic phosphorylation of histone H3: spatio-temporal regulation by mammalian Aurora kinases. Molecular and cellular biology 22(3):874-85
  8. Ref:12123289: Waterborg JH (2002) Dynamics of histone acetylation in vivo. A function for acetylation turnover? Biochemistry and cell biology = Biochimie et biologie cellulaire 80(3):363-78
  9. Ref:12297044: Taverna SD, Coyne RS, Allis CD (2002) Methylation of histone h3 at lysine 9 targets programmed DNA elimination in tetrahymena. Cell 110(6):701-11
  10. Ref:11891286: Shang Y, Song X, Bowen J, Corstanje R, Gao Y, Gaertig J, Gorovsky MA (2002) A robust inducible-repressible promoter greatly facilitates gene knockouts, conditional expression, and overexpression of homologous and heterologous genes in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 99(6):3734-9
  11. Ref:12455963: Duharcourt S, Yao MC (2002) Role of histone deacetylation in developmentally programmed DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 1(2):293-303
  12. Ref:11972045: Dou Y, Gorovsky MA (2002) Regulation of transcription by H1 phosphorylation in Tetrahymena is position independent and requires clustered sites. Proceedings of the National Academy of Sciences of the United States of America 99(9):6142-6
  13. Ref:11467741: Green GR (2001) Phosphorylation of histone variant regions in chromatin: unlocking the linker? Biochemistry and cell biology = Biochimie et biologie cellulaire 79(3):275-87
  14. Ref:11751634: Briggs SD, Bryk M, Strahl BD, Cheung WL, Davie JK, Dent SY, Winston F, Allis CD (2001) Histone H3 lysine 4 methylation is mediated by Set1 and required for cell growth and rDNA silencing in Saccharomyces cerevisiae. Genes & development 15(24):3286-95
  15. Ref:11135657: Tan S (2001) One HAT size fits all? Nature structural biology 8(1):8-10
  16. Ref:11112280: Trievel RC, Li FY, Marmorstein R (2000) Application of a fluorescent histone acetyltransferase assay to probe the substrate specificity of the human p300/CBP-associated factor. Analytical biochemistry 287(2):319-28
  17. Ref:9396628: Fogel GB, Brunk CF (1997) Expression of Tetrahymena histone H4 in yeast. Biochimica et biophysica acta 1354(2):116-26
  18. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  19. Ref:8415695: Kahn RW, Andersen BH, Brunk CF (1993) Transformation of Tetrahymena thermophila by microinjection of a foreign gene. Proceedings of the National Academy of Sciences of the United States of America 90(20):9295-9
  20. Ref:1885002: Lin R, Cook RG, Allis CD (1991) Proteolytic removal of core histone amino termini and dephosphorylation of histone H1 correlate with the formation of condensed chromatin and transcriptional silencing during Tetrahymena macronuclear development. Genes & development 5(9):1601-10
  21. Ref:3360847: Richman R, Chicoine LG, Collini MP, Cook RG, Allis CD (1988) Micronuclei and the cytoplasm of growing Tetrahymena contain a histone acetylase activity which is highly specific for free histone H4. The Journal of cell biology 106(4):1017-26
  22. Ref:3822803: Horowitz S, Bowen JK, Bannon GA, Gorovsky MA (1987) Unusual features of transcribed and translated regions of the histone H4 gene family of Tetrahymena thermophila. Nucleic acids research 15(1):141-60
  23. Ref:3785221: Pederson DS, Shupe K, Bannon GA, Gorovsky MA (1986) Formation of stable chromatin structures on the histone H4 gene during differentiation in Tetrahymena thermophila. Molecular and cellular biology 6(8):3014-7
  24. Ref:3023930: Harrison GS, Findly RC, Karrer KM (1986) Site-specific methylation of adenine in the nuclear genome of a eucaryote, Tetrahymena thermophila. Molecular and cellular biology 6(7):2364-70
  25. Ref:6322129: Bannon GA, Bowen JK, Yao MC, Gorovsky MA (1984) Tetrahymena H4 genes: structure, evolution and organization in macro- and micronuclei. Nucleic acids research 12(4):1961-75

Sequences 

>TTHERM_00498190(coding)
ATGGCCGGTGGTAAAGGTGGTAAAGGTATGGGTAAAGTCGGAGCCAAGAGACACTCCAGA
AAGTCTAACAAGGCTTCCATTGAAGGTATTACTAAGCCCGCTATCAGAAGATTAGCTAGA
AGAGGTGGTGTTAAGAGAATTTCCTCTTTCATTTACGACGACTCCAGACAAGTCTTGAAG
TCTTTCTTAGAAAACGTTGTTAGAGACGCTGTCACTTACACTGAACACGCTAGAAGAAAA
ACCGTCACTGCTATGGACGTTGTCTACGCCCTCAAGAGACAAGGCAGAACTCTCTATGGT
TTCGGTGGTTGA


>TTHERM_00498190(protein)
MAGGKGGKGMGKVGAKRHSRKSNKASIEGITKPAIRRLARRGGVKRISSFIYDDSRQVLK
SFLENVVRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG


>TTHERM_00498190(gene)
ATGGCCGGTGGTAAAGGTGGTAAAGGTATGGGTAAAGTCGGAGCCAAGAGACACTCCAGA
AAGTCTAACAAGGCTTCCATTGAAGGTATTACTAAGCCCGCTATCAGAAGATTAGCTAGA
AGAGGTGGTGTTAAGAGAATTTCCTCTTTCATTTACGACGACTCCAGACAAGTCTTGAAG
TCTTTCTTAGAAAACGTTGTTAGAGACGCTGTCACTTACACTGAACACGCTAGAAGAAAA
ACCGTCACTGCTATGGACGTTGTCTACGCCCTCAAGAGACAAGGCAGAACTCTCTATGGT
TTCGGTGGTTGA