Identifiers and Description

Gene Model Identifier

TTHERM_00129830

Standard Name

HEX1 (beta-HEXosaminidase )

Aliases

PreTt09534 | 9.m00555 | 3699.m00263

Description

Lysosomal beta-hexosaminidase; synthesized as a precursor that is processed into several mature glycosylated isozymes; isozymes are secreted during both growth and starvation; a fraction remains covalently bound to the plasma membrane

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF02838 ) Glycosyl hydrolase family 20, domain
  • ( PF00728 ) Glycosyl hydrolase family 20, catalytic

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 89.5%

TetraMine Data

TTHERM_00129830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13349.19.997093137033517e-262glycosyl hydrolase family 20,
catalytic domain-containing pr
otein (553 aa)
OxytrichaContig14777.0.g762.000383902553626e-98Glycosyl hydrolase family 20,
catalytic domain
DictyBaseDDB_G02875972.0009381340492598e-66nagC on chromosome: 5 position
449924 to 451697
WormBaseWBGene000205091.9997255150861791e-53locus:hex-1 Beta-hexosaminid
ase A status:Confirmed Uni
Prot:Q22492 protein_id:CCD68
941.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:8022306: Bencsáth M, Darvas Z, Csaba G (1994) Secretory response of Tetrahymena to insulin: the influence of electric pulses. Microbios 78(314):27-33
  2. Ref:8482338: Kiy T, Vosskühler C, Rasmussen L, Tiedtke A (1993) Three pools of lysosomal enzymes in Tetrahymena thermophila. Experimental cell research 205(2):286-92
  3. Ref:8366828: Bencsáth M, Darvas Z, Csaba G (1993) The effect of an electric field on the release of hexosaminidase in Tetrahymena. Microbios 74(301):227-32
  4. Ref:1386323: Rasmussen L, Florin-Christensen M, Florin-Christensen J, Kiy T, Tiedtke A (1992) Differential increase in activity of acid phosphatase induced by phosphate starvation in Tetrahymena. Experimental cell research 201(2):522-5
  5. Ref:1368701: Kiy T, Tiedtke A (1991) Lysosomal enzymes produced by immobilized Tetrahymena thermophila. Applied microbiology and biotechnology 35(1):14-8
  6. Ref:2971351: Hünseler P, Tiedtke A, von Figura K (1988) Biosynthesis of secreted beta-hexosaminidase in Tetrahymena thermophila. A comparison of the wild type with a secretory mutant. The Biochemical journal 252(3):837-42
  7. Ref:2954837: Banno Y, Sasaki N, Nozawa Y (1987) Secretion heterogeneity of lysosomal enzymes in Tetrahymena pyriformis. Experimental cell research 170(2):259-68
  8. Ref:43892: Vick GW, Blum JJ (1979) Secretion of hexosaminidase isozymes by Tetrahymena. The Journal of protozoology 26(3):510-8
  9. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00129830(coding)
ATGCAAAAGATACTTTTAATTACTTTCCTTCTTGGAATAGCTCTCGCTCAAATTACTCCT
GGCGTTGACCCTATTTCAGCTAAGGTTATGCCTAAACCTAAGAATTACACTTATGGAGAT
TTGAGCTTACTTGTCACTGATCCTTGCGGAATCTCTTACAGACCTTCTGTTGGGTCAGGA
AAAGTACCCAACCATGTCTATCAAATTATTGGATTCTACACTTTGAATATTTTCAATTCT
AACGAAAACTCTTGTGCTATGTAAAGAGAATTGTATAAGAATGAAACAACCATTGAAAAG
ATGCGTAGATTACAACATTCCTAAAATATAGTCTTCGATATTTTTATCTAAGACGCTGCT
TTGGCCACTGCAGACACACTCGAAGACGAATATTATGATTTATAAATTTATAATACCACA
TATTGGAAATTGACTGCTAACAAATATGTTGGTTTACTCCGTGGTTTAGAAACTTACTCT
CAATTATTCACTTAAGACGAAGACACTGAAGATTGGTATTTGAATAACATCCCTATTTCT
ATTCAAGATTAACCTGACTACATCTACAGAGGTCTTATGATAGATTCAGCCAGACATTTC
TTATCAGTTGAAACTATTTTAAAAACTATTGATTCTATGTTATTCAACAAGTTGAATGTT
CTCCATTGGCACATCACTGATACTGAATCCTTCCCCTTCCCTCTTAAATCATTCCCTAAT
ATTACTAAATATGGAGCCTACTCTAAGAAGAAACAATACAGCTTCGAAGACATTTAATAC
ATTGTAGACTAAGCTCTCAACAAGGGTATTTAAGTTATTCCTGAAGTCGATTCTCCAGGA
CACGCTTTTTCATGGGCTAGATCTCCTTAATTCTCTAGTATTGGTCTATTATGTGATTAA
TATAATGGATAGTTAGACCCAACACTAAATTTAACTTACACTGCTGTTAAGGGTATTATG
GAAGATATGAATACTTAATTCTACACTGCTAAGTATGTTCATTTTGGTGGTGATGAAGTT
GAAGAATAATGCTGGAATAAACGCCCTGAAATTAAGGAATTCATGAATTAAAATAACATC
TCTACATATACTGATTTGTAGAATTATTACAGAAAGAACTAAGTTAACATTTGGAAATCA
ATTAATGCTACTAAGCCTGCTATTTTCTGGGCAGATTCAAATACTTTGAAATATGGTCCT
GATGATATTATTCAATGGTGGGGATCTACTCATGATTTTTCTTCAATCAAAGATCTTCCT
AACAAAATAATTTTATCTTTCTATGATAATACTTATTTGGATGTTGGTGAGGGAAATAGA
TATGGTGGAAGTTATGGCAGCATGTATAACTGGGATGTCTTAAACTCTTTCAATCCTAGA
GTTCCTGGAATTAAGGGTGAAATTCTTGGTGGCGAAACATGCTTATGGAGTGAAATGAAT
GATGATTCTACTTAATTCTAAAGACTTTGGACAAGAAATAGTGCATTTGCTGAAAGACTT
TGGAACACTGACGCTGCTAATAATGAAACTTACAAAACTAGAGCTTTAGTTAGCAGAATG
GTCTTTATGCAACACCGTTTAACTGCTAGAGGAATCCCTGCTTCTCCTGTAACAGTTGGT
ATTTGTGAATAAAACCTTTCTCTCTGCTACAATTGA


>TTHERM_00129830(protein)
MQKILLITFLLGIALAQITPGVDPISAKVMPKPKNYTYGDLSLLVTDPCGISYRPSVGSG
KVPNHVYQIIGFYTLNIFNSNENSCAMQRELYKNETTIEKMRRLQHSQNIVFDIFIQDAA
LATADTLEDEYYDLQIYNTTYWKLTANKYVGLLRGLETYSQLFTQDEDTEDWYLNNIPIS
IQDQPDYIYRGLMIDSARHFLSVETILKTIDSMLFNKLNVLHWHITDTESFPFPLKSFPN
ITKYGAYSKKKQYSFEDIQYIVDQALNKGIQVIPEVDSPGHAFSWARSPQFSSIGLLCDQ
YNGQLDPTLNLTYTAVKGIMEDMNTQFYTAKYVHFGGDEVEEQCWNKRPEIKEFMNQNNI
STYTDLQNYYRKNQVNIWKSINATKPAIFWADSNTLKYGPDDIIQWWGSTHDFSSIKDLP
NKIILSFYDNTYLDVGEGNRYGGSYGSMYNWDVLNSFNPRVPGIKGEILGGETCLWSEMN
DDSTQFQRLWTRNSAFAERLWNTDAANNETYKTRALVSRMVFMQHRLTARGIPASPVTVG
ICEQNLSLCYN


>TTHERM_00129830(gene)
ATGCAAAAGATACTTTTAATTACTTTCCTTCTTGGAATAGCTCTCGCTCAAATTACTCCT
GGCGTTGACCCTATTTCAGCTAAGGTTATGCCTAAACCTAAGAATTACACTTATGGAGAT
TTGAGCTTACTTGTCACTGATCCTTGCGGAATCTCTTACAGACCTTCTGTTGGGTCAGGA
AAAGTACCCAACCATGTCTATCAAATTATTGGATTCTACACTTTGAATATTTTCAATTCT
AACGAAAACTCTTGTGCTATGTAAAGAGAATTGTATAAGAATGAAACAACCATTGAAAAG
ATGCGTAGATTACAACATTCCTAAAATATAGTCTTCGATATTTTTATCTAAGACGCTGCT
TTGGCCACTGCAGACACACTCGAAGACGAATATTATGATTTATAAATTTATAATACCACA
TATTGGAAATTGACTGCTAACAAATATGTTGGTTTACTCCGTGGTTTAGAAACTTACTCT
CAATTATTCACTTAAGACGAAGACACTGAAGATTGGTATTTGAATAACATCCCTATTTCT
ATTCAAGATTAACCTGACTACATCTACAGAGGTCTTATGATAGATTCAGCCAGACATTTC
TTATCAGTTGAAACTATTTTAAAAACTATTGATTCTATGTTATTCAACAAGTTGAATGTT
CTCCATTGGCACATCACTGATACTGAATCCTTCCCCTTCCCTCTTAAATCATTCCCTAAT
ATTACTAAATATGGAGCCTACTCTAAGAAGAAACAATACAGCTTCGAAGACATTTAATAC
ATTGTAGACTAAGCTCTCAACAAGGGTATTTAAGTTATTCCTGAAGTCGATTCTCCAGGA
CACGCTTTTTCATGGGCTAGGTAACTATTTCAAAAAAGAATATTAAACTTTAAACATTTT
TAAGATTTAAATTATTATCATATATTTAATTTTAATATTAGCTATTTACTTATAATTATT
TTAATAATTTTTAGATCTCCTTAATTCTCTAGTATTGGTCTATTATGTGATTAATATAAT
GGATAGTTAGACCCAACACTAAATTTAACTTACACTGCTGTTAAGGGTATTATGGAAGAT
ATGAATACTTAATTCTACACTGCTAAGTATGTTCATTTTGGTGGTGATGAAGTTGAAGAA
TAATGCTGGAATAAACGCCCTGAAATTAAGGAATTCATGAATTAAAATAACATCTCTACA
TATACTGATTTGTAGAATTATTACAGAAAGAACTAAGTTAACATTTGGAAATCAATTAAT
GCTACTAAGCCTGCTATTTTCTGGGCAGATTCAAATACTTTGGTAAATATATTTAAAATA
TTTATATCTATAATATCATACTTTATTAATATAGAAATATGGTCCTGATGATATTATTCA
ATGGTGGGGATCTACTCATGATTTTTCTTCAATCAAAGATCTTCCTAACAAAATAATTTT
ATCTTTCTATGATAATACTTATTTGGATGTTGGTAATCAAATATATATTTTATATTGTAA
ATTAAATTTAATGAATTAATTTTTTAGGTGAGGGAAATAGATATGGTGGAAGTTATGGCA
GCATGTATAACTGGGATGTCTTAAACTCTTTCAATCCTAGAGTTCCTGGAATTAAGGGTG
AAATTCTTGGTGGCGAAACATGCTTATGGAGTGAAATGAATGATGATTCTACTTAATTCT
AAAGACTTTGGACAAGAAATAGTGCATTTGCTGAAAGACTTTGGAACACTGACGCTGCTA
ATAATGAAACTTACAAAACTAGAGCTTTAGTTAGCAGAATGGTCTTTATGCAACACCGTT
TAACTGCTAGAGGAATCCCTGCTTCTCCTGTAACAGTTGGTATTTGTGAATAAAACCTTT
CTCTCTGCTACAATTGA