Identifiers and Description

Gene Model Identifier

TTHERM_00433810

Standard Name

HEN1 (Tetrahymena HEN1 homolog)

Aliases

PreTt26522 | 48.m00285 | 3831.m01622

Description

RNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00433810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04218.19.997093137033517e-262hypothetical protein (420 aa)
Stentor CoeruleusSteCoe_139618.533047625744066e-17
OxytrichaContig5211.0.g500.00000000000020009182674645818hypothetical protein
WormBaseWBGene000153490.000000009996807949091551locus:henn-1 Uncharacterized
protein C02F5.6 status:Part
ially_confirmed UniProt:P342
83 protein_id:CCD62631.1

General Information

Paragraph NoGene NameParagraph Text
109HEN1,
TWI1
Twi1p-associated scnRNAs are 2'-O-methylated at their 3' ends by the RNA methyltransferase Hen1p (Kurth & Mochizuki 2009).

Associated Literature

  1. Ref:19240163: Kurth HM, Mochizuki K (2009) 2'-O-methylation stabilizes Piwi-associated small RNAs and ensures DNA elimination in Tetrahymena. RNA (New York, N.Y.) 15(4):675-85

Sequences

>TTHERM_00433810(coding)
ATGATTGAAGCTTATGAAACAGATGTGTTTATGGATCCTATTGGTATGAAAGTTTGGGAA
AAAAGGCACTAATATGTAGCAACTAAGTTATCGGCTCTGAATTGTAAAAGAGTTTTGGAT
ATGGGAACAAATACTTGCAAGCTCATATAAAGACTTTCAAGGAGTTTGTAATTCACTTAA
ATAGATGGTTTAGATATCGATGGCTAATTGCTTGAGACTCAAGGAATCCAAAATGCGAAG
CCAGATTTGATATAAAATTAATATGCCAGTATGAGAGACCATTAGCTAGTGGTAAATCTA
TACCAAGGCAGTGCTTTGAATAAGATTTAACATTTGAAGGATTAGCAATACGATGCTGTA
ATATTAGTTGAACTCATTGAGCACTTATAAGTAGAAGATGTTTTTCTTATTGAGTAAAAT
TTGTTTGGCTTTTTGAGGCCACAATTTGTGATTGTGACTACACCTAACTCTGATTTTAAT
GTTTATTTTAACTTTAAAGAATAAGGAGTATTGTTTAGGGACAAAGATCACAAATTTGAG
TGGTCCTAAAACTAGTTTTAGATTTGGGCCTAAAAAGTATGCTAAAATTATGGATACAAA
GTAATAGAGTTGACAGGAGTAGGCGAACATAAAACAGAAGGAACTAAGAACGGTTTTTGT
ACACAAATAGTTGTATTTGAGAAAGATACCCAACAAGAGAAGTATCTGAACTTTGCTTTC
TTCAACCTTCAAGAGGGAGAAATTCGTTAAGTATGTTAAATTCTGTACCCATTTGAGAGT
AAAGAATAACATTTTCAAAGAGAAGTAGTAGACAGTATCAGATATATTCTGCATATTACT
GATAAGTAAAATTAATTCGAAGATGGTTCATACTAAAATTATACTACTCTCTCTCGCATA
ATGCAAAATCATTCAATATCAAGTAATTGGTAAATTTAAGGTGATTACTTTAAACTTAAA
ACCTACATCCAGAATATTTCTGAGTTTTTGGTACATGAAAATTAGTTCAATTTTCAAGAA
TCTTTCGTCACTCTCAATTATTAAGCCTAAATGGAAGATGAAGAAAATGAAGATTAGCTT
GAAAGCGATTCTGAAAATGTAAAGATGCAATAATAACAATATTACTTTTCTAACGATAAT
TGTTTCTCCACAAAAGATACCACTTATAGCAGTTTTTCCACTGCAGATAACTTATTCTCC
TAAAAAATTTAACTTGGTTAGCAATAAATGGCTTTAGAGGAAATAGAATTAGAAGATACA
ATTGATTATTGA


>TTHERM_00433810(protein)
MIEAYETDVFMDPIGMKVWEKRHQYVATKLSALNCKRVLDMGTNTCKLIQRLSRSLQFTQ
IDGLDIDGQLLETQGIQNAKPDLIQNQYASMRDHQLVVNLYQGSALNKIQHLKDQQYDAV
ILVELIEHLQVEDVFLIEQNLFGFLRPQFVIVTTPNSDFNVYFNFKEQGVLFRDKDHKFE
WSQNQFQIWAQKVCQNYGYKVIELTGVGEHKTEGTKNGFCTQIVVFEKDTQQEKYLNFAF
FNLQEGEIRQVCQILYPFESKEQHFQREVVDSIRYILHITDKQNQFEDGSYQNYTTLSRI
MQNHSISSNWQIQGDYFKLKTYIQNISEFLVHENQFNFQESFVTLNYQAQMEDEENEDQL
ESDSENVKMQQQQYYFSNDNCFSTKDTTYSSFSTADNLFSQKIQLGQQQMALEEIELEDT
IDY


>TTHERM_00433810(gene)
AAAATAATTAAAAGTGCAAAAAAAAAAAATTAGAAATCTACCAAATAAACAAAAAGAAAG
AAAGAAAAAAATTTATTTATATTAAAAATGATTGAAGCTTATGAAACAGATGTGTTTATG
GATCCTATTGGTATGAAAGTTTGGGAAAAAAGGCACTAATATGTAGCAACTAAGTTATCG
GCTCTGAATTGTAAAAGAGTAAGATTAAAAACACATTTGATATTAAGATTGCTATTAACC
CTGATTTCATATTTTGTTAATAAATTAAGGTTTTGGATATGGGAACAAATACTTGCAAGC
TCATATAAAGACTTTCAAGGAGTTTGTAATTCACTTAAATAGTAAAATATCATTTTTCAA
TAATATTTGAATAGATTAATTAGTTTTATTCTTTAGGATGGTTTAGATATCGATGGCTAA
TTGCTTGAGACTCAAGGAATCCAAGTATAAATAATTTTAAATACGATTATAAAATAAATA
GTAAACATAAAACTTAGAATGCGAAGCCAGATTTGATATAAAATTAATATGCCAGTATGA
GAGACCATTAGCTAGTGGTAAATCTATACCAAGGCAGTGCTTTGAATAAGATTTAACATT
TGAAGGATTAGCAATACGATGCTGTAATATTAGTTGAACTCATTGAGCACTTATAAGTAG
AAGATGTTTTTCTTATTGAGTAAAATTTGTTTGGCTTTTTGAGGCCACAATTTGTGATTG
TGACTACACCTAACTCTGATTTTAATGTTTATTTTAACTTTAAGTAAAATCTTACAATTC
TAATAAAGGAAATTTAATGAATTATTTTTTATTTTCTAGAGAATAAGGAGTATTGTTTAG
GGACAAAGATCACAAATTTGAGTGGTCCTAAAACTAGTTTTAGATTTGGGCCTAAAAAGT
ATGCTAAAATTATGGTAAAACAAGAAGATAACTAAATGTTAAGTGAACTTATTATTTATT
TTTAATTTGTTTAGGATACAAAGTAATAGAGTTGACAGGAGTAGGCGAACATAAAACAGA
AGGAACTAAGAACGGTTTTTGTACACAAATAGTTGTATTTGAGAAAGATACCCAACAAGA
GAAGTATCTGAACTTTGCTTTCTTGTAAAAATTATTGATAAATAGTTTATTTAATTATTA
TTTTTTTAACTGAAAAAAGCAACCTTCAAGAGGGAGAAATTCGTTAAGTATGTTAAATTC
TGTACCCATTTGAGAGTAAAGAATAACATTTTCAAAGAGAAGTAGTAGACAGTATCAGGT
ATTTAATTTATTAAGAAATAGATTTTAAATACTTTTTTGAGACTAAATATTTTTTATTTC
TAATTAGATATATTCTGCATATTACTGATAAGTAAAATTAATTCGAAGATGGTTCATACT
AAAATTATACTACTCTCTCTCGCATAATGCAAAATCATTCAATATCAAGTAATTGGTAAA
TTTAAGGTGATTACTTTAAACTTAAAACCTACATCCAGAATATTTCTGAGTTTTTGGTAC
ATGAAAATTAGTTCAATTTTCAAGAATCTTTCGTCACTCTCAATTATTAAGCCTAAATGG
AAGATGAAGAAAATGAAGATTAGCTTGAAAGCGATTCTGAAAATGTAAAGATGCAATAAT
AACAATATTACTTTTCTAACGATAATTGTTTCTCCACAAAAGATACCACTTATAGCAGTT
TTTCCACTGCAGATAACTTATTCTCCTAAAAAATTTAACTTGGTTAGCAATAAATGGCTT
TAGAGGAAATAGAATTAGAAGATACAATTGATTATTGA