Identifiers and Description

Gene Model Identifier

TTHERM_00439000

Standard Name

HEM15 (HEMe biosynthesis)

Aliases

PreTt05457 | 49.m00229 | 3708.m00078

Description

ferrochelatase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00439000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12426.19.997093137033517e-262ferrochelatase (370 aa)
DictyBaseDDB_G02888916.998759398018207e-85hemH on chromosome: 5 position
2088484 to 2089755
SGDYOR176W9.996373193201036e-79HEM15 Ferrochelatase, a mitoch
ondrial inner membrane protein
, catalyzes the insertion of f
errous iron into protoporphyri
n IX, the eighth and final ste
p in the heme biosynthetic pat
hway
Stentor CoeruleusSteCoe_293614.0795586671775603e-41

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00439000(coding)
ATGCTTAGTTAGATATTCAGTAGAACTTTTTCATCTAGCAAATAACAAGCTAAAACAGCT
GTTTTTATGCTTAATTTAGGTGGACCTAATAGCTTAGAAGAAGTATCTCCATTTTTAGAG
AGATTCTTCGCAGACTCTACAGTCATCAGAATACCTTTTGGTTTAGGACCTAAGATTGGT
AAGCTACGTGGTCCTGCCAAAGTTACCAAGTAGTATGAAGCTATTGGAGGAAGAAGCCCT
ATTCAAGATTGGACAAGAAAATAAGGTGAAAAAATGGTTGAAAAATTAGATTAAATTTCA
CCAGACACAGCTCCTCATATTTATTTTCCAGCATTCAGATATGGACTTCCTCTTTACACT
GAATCTATTAAAGAATGTATTGAAAAGAATCCAACTGTAGAAAAATTTGTATTTTTTTCA
TAGTATCCTTAATATTCTTGCACTACAGCTGGAAATAACATTAGAGAAGCATTAAAACAT
TTAAAGGAGCAGTATAAAAACCATGGAAAAACCATCCATGTGATTGATAGATGGTATAAT
CATCCTGGTTATGTTAAAACAATTTCTAGATTGCTCTCAGAAGACCTTAAAAATAACTTT
AAAGAGGAAGATAGAGATAATGTATTAATATTATTTTCTGCTCACAGTCTCCCATTTGAT
TTTGTTAAGCAAGGTGATACATATCCATATGAAATAGGAACTACTGCAAATTTAGTAATT
TAAGAAGCTAAATTGAAGAACCCACACAGAGTTGTTTGGCAAAGTAAAGTTGGTTTCTAA
CAATGGTTAGCACCAAACACTATGCATGCATTAGAATAGGCTTCTAATTAAGGTTGGAAA
AATGTTATCTTAGTTCCTCTAGGTTTCACTAGTGATCACTTAGAAACACTCTATGAATTA
GATTTAGAATATATCAAGGAAAGTTAGGAAAAATTAAAGTTTAATAAAATAATAAGAGCA
AGAAGTTTAAATGATGATCAATAATTTTGTGATTCCTTAGCAGATATTGTTTCTTAGAAT
TTAAAAACTGATGCTTATAAATCTCCAAATTTAAAACTAAGATGCCCTGATTGCAAAATA
CCTGAATGCAACTTACTAAGTGCAGTTTGA


>TTHERM_00439000(protein)
MLSQIFSRTFSSSKQQAKTAVFMLNLGGPNSLEEVSPFLERFFADSTVIRIPFGLGPKIG
KLRGPAKVTKQYEAIGGRSPIQDWTRKQGEKMVEKLDQISPDTAPHIYFPAFRYGLPLYT
ESIKECIEKNPTVEKFVFFSQYPQYSCTTAGNNIREALKHLKEQYKNHGKTIHVIDRWYN
HPGYVKTISRLLSEDLKNNFKEEDRDNVLILFSAHSLPFDFVKQGDTYPYEIGTTANLVI
QEAKLKNPHRVVWQSKVGFQQWLAPNTMHALEQASNQGWKNVILVPLGFTSDHLETLYEL
DLEYIKESQEKLKFNKIIRARSLNDDQQFCDSLADIVSQNLKTDAYKSPNLKLRCPDCKI
PECNLLSAV


>TTHERM_00439000(gene)
ATGCTTAGTTAGATATTCAGTAGAACTTTTTCATCTAGCAAATAACAAGCTAAAACAGCT
GTTTTTATGCTTAATTTAGGTGGACCTAATAGCTTAGAAGAAGTATCTCCATTTTTAGAG
AGATTCTTCGCAGACTCTACAGTCATCAGAATACCTTTTGGTTTAGGTTAGAAATTAGAT
TTGATTTTTAATTAGATTTATGCAAAAAAAAAATGAGAGAGAGATCAAAATTTAGAAAAT
AAAGGGATTATTTAATAATTATTTGAACTTATTAATAATAAATAGGACCTAAGATTGGTA
AGCTACGTGGTCCTGCCAAAGTTACCAAGTAGTATGAAGCTATTGGAGGAAGAAGCCCTA
TTCAAGATTGGACAAGAAAATAAGGTGAAAAAATGGTTGAAAAATTAGATTAAATTTCAC
CAGACACAGCTCCTCATATTTATTTTCCAGCATTCAGATATGGACTTCCTCTTTACACTG
AATCTATTAAAGAATGTATTGAAAAGAATCCAACTGTAGAAAAATTTGTATTTTTTTCAT
AGTATCCTTAATATTCTTGCACTACAGCTGGAAATAACATTAGAGAAGCATTAAAACATT
TAAAGGAGCAGTATAAAAACCATGGAAAAACCATCCATGTGATTGATAGATGGTATAATC
ATCCTGGTTATGTTAAAACAATTTCTAGATTGCTCTCAGAAGACCTTAAAAATAACTTTA
AAGAGGTTTGTTCAAAAATTAATTTTATTGTTGAAAAATAAAAATATCTTTTTTAATAAA
ATAAATCTGAATAGGAAGATAGAGATAATGTATTAATATTATTTTCTGCTCACAGTCTCC
CATTTGATTTTGTTAAGCAAGGTGATACATATCCATATGAAATAGGAACTACTGCAAATT
TAGTAATTTAAGAAGCTAAATTGAAGAACCCACACAGAGTTGTTTGGCAAAGTAAAGTTG
GTTTCTAACAATGGTTAGCACCAAACACTATGCATGCATTAGAATAGGCTTCTAATTAAG
GTTGGAAAAATGTTATCTTAGTTCCTCTAGGTTTCACTAGTGATCACTTAGAAACACTCT
ATGAATTAGATTTAGAATATATCAAGGAAAGTTAGGAAAAATTAAAGTTTAATAAAATAA
TAAGAGCAAGAAGTTTAAATGATGATCAATAATTTTGTGATTCCTTAGCAGATATTGTTT
CTTAGAATTTAAAAACTGATGCTTATAAATCTCCAAATTTAAAACTAAGATGCCCTGATT
GCAAAATACCTGAATGCAACTTACTAAGTGCAGTTTGA