Identifiers and Description

Gene Model Identifier

TTHERM_00535150

Standard Name

HEM1 (HEMoglobin 1 )

Aliases

PreTt03100 | 69.m00142 | hemoglobin | 3718.m00004

Description

HEM1 protozoan/cyanobacterial globin family protein; Hemoglobin; oxygen binding hemoprotein homologous to hemoproteins from cyanobacteria and other protozoans- but distinct from the globin family hemoproteins such as mammalian hemoglobin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01152 ) protozoan/cyanobacterial globin family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.9%

TetraMine Data

TTHERM_00535150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11240.15.001742359316081e-68protozoan/cyano globin family
protein (121 aa)
OxytrichaContig536.1.g1348.000721090200152e-18Bacterial-like globin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15596552: Shikama K, Matsuoka A (2004) Structure-function relationships in unusual nonvertebrate globins. Critical reviews in biochemistry and molecular biology 39(4):217-59
  2. Ref:8547335: Thorsteinsson MV, Bevan DR, Ebel RE, Weber RE, Potts M (1996) Spectroscopical and functional characterization of the hemoglobin of Nostoc commune (UTEX 584 (Cyanobacterial). Biochimica et biophysica acta 1292(1):133-9
  3. Ref:9022709: Couture M, Guertin M (1996) Purification and spectroscopic characterization of a recombinant chloroplastic hemoglobin from the green unicellular alga Chlamydomonas eugametos. European journal of biochemistry 242(3):779-87
  4. Ref:8587498: Moens L, Vanfleteren J, Van de Peer Y, Peeters K, Kapp O, Czeluzniak J, Goodman M, Blaxter M, Vinogradov S (1996) Globins in nonvertebrate species: dispersal by horizontal gene transfer and evolution of the structure-function relationships. Molecular biology and evolution 13(2):324-33
  5. Ref:7578257: Yamauchi K, Tada H, Usuki I (1995) Structure and evolution of Paramecium hemoglobin genes. Biochimica et biophysica acta 1264(1):53-62
  6. Ref:8029002: Schüll C, Beier H (1994) Three Tetrahymena tRNA(Gln) isoacceptors as tools for studying unorthodox codon recognition and codon context effects during protein synthesis in vitro. Nucleic acids research 22(11):1974-80
  7. Ref:8485156: Takagi T, Iwaasa H, Yuasa H, Shikama K, Takemasa T, Watanabe Y (1993) Primary structure of Tetrahymena hemoglobins. Biochimica et biophysica acta 1173(1):75-8
  8. Ref:2111321: Iwaasa H, Takagi T, Shikama K (1990) Protozoan hemoglobin from Tetrahymena pyriformis. Isolation, characterization, and amino acid sequence. The Journal of biological chemistry 265(15):8603-9

Sequences

>TTHERM_00535150(coding)
ATGAACAAATAGCCTACTGTTTTTGAAAAGCTTGGAGGATAGGCAGCTATGCATGCAGCT
GTTCCCCTTTTCTACAAGAAAGTCTTAGCAGATGATAGAGTCAAACATTACTTTAAAAAC
ACTAATATGGAACACCAAGCTAAGTAATAGGAAGATTTTCTTACTATGCTTTTAGGAGGA
CCCAATCATTATAAAGGAAAAAACATGGCTGAAGCTCATAAAGGTATGAACCTTTAAAAC
TCTCACTTTGACGCTATCATTGAGAATCTTGCCGCCACACTTAAAGAATTAGGAGTTAGC
GATTAAATTATTGGTGAAGCAGCCAAGGTCATTGAACACACTCGTAAAGACTGTCTTGGA
AAGTGA


>TTHERM_00535150(protein)
MNKQPTVFEKLGGQAAMHAAVPLFYKKVLADDRVKHYFKNTNMEHQAKQQEDFLTMLLGG
PNHYKGKNMAEAHKGMNLQNSHFDAIIENLAATLKELGVSDQIIGEAAKVIEHTRKDCLG
K


>TTHERM_00535150(gene)
ATGAACAAATAGCCTACTGTTTTTGAAAAGCTTGGAGGATAGGCAGCTATGCATGCAGCT
GTTCCCCTTTTCTACAAGAAAGTCTTAGCAGATGATAGAGTCAAACATTACTTTAAAAAC
ACTAATATGGAACACCAAGCTAAGTAATAGGAAGATTTTCTTACTATGCTTTTAGGAGGA
CCCAATCATTATAAAGGAAAAAACATGGCTGAAGCTCATAAAGGTATGAACCTTTAAAAC
TCTCACTTTGACGCTATCATTGAGAATCTTGCCGCCACACTTAAAGAATTAGGAGTTAGC
GATTAAATTATTGGTGAAGCAGCCAAGGTCATTGAACACACTCGTAAAGACTGTCTTGGA
AAGTGA