Identifiers and Description

Gene Model Identifier

TTHERM_00535150

Standard Name

HEM1 (HEMoglobin )

Aliases

PreTt03100 | 69.m00142 | hemoglobin | 3718.m00004

Description

Hemoglobin; oxygen binding hemoprotein homologous to hemoproteins from cyanobacteria and other protozoans, but distinct from the globin family hemoproteins such as mammalian hemoglobin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01152 ) protozoan/cyanobacterial globin family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.9%

TetraMine Data

TTHERM_00535150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11240.15.001742359316081e-68protozoan/cyano globin family
protein (121 aa)
OxytrichaContig536.1.g1348.000721090200152e-18Bacterial-like globin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15596552: Shikama K, Matsuoka A (2004) Structure-function relationships in unusual nonvertebrate globins. Critical reviews in biochemistry and molecular biology 39(4):217-59
  2. Ref:8547335: Thorsteinsson MV, Bevan DR, Ebel RE, Weber RE, Potts M (1996) Spectroscopical and functional characterization of the hemoglobin of Nostoc commune (UTEX 584 (Cyanobacterial). Biochimica et biophysica acta 1292(1):133-9
  3. Ref:9022709: Couture M, Guertin M (1996) Purification and spectroscopic characterization of a recombinant chloroplastic hemoglobin from the green unicellular alga Chlamydomonas eugametos. European journal of biochemistry 242(3):779-87
  4. Ref:8587498: Moens L, Vanfleteren J, Van de Peer Y, Peeters K, Kapp O, Czeluzniak J, Goodman M, Blaxter M, Vinogradov S (1996) Globins in nonvertebrate species: dispersal by horizontal gene transfer and evolution of the structure-function relationships. Molecular biology and evolution 13(2):324-33
  5. Ref:7578257: Yamauchi K, Tada H, Usuki I (1995) Structure and evolution of Paramecium hemoglobin genes. Biochimica et biophysica acta 1264(1):53-62
  6. Ref:8029002: Schüll C, Beier H (1994) Three Tetrahymena tRNA(Gln) isoacceptors as tools for studying unorthodox codon recognition and codon context effects during protein synthesis in vitro. Nucleic acids research 22(11):1974-80
  7. Ref:8485156: Takagi T, Iwaasa H, Yuasa H, Shikama K, Takemasa T, Watanabe Y (1993) Primary structure of Tetrahymena hemoglobins. Biochimica et biophysica acta 1173(1):75-8
  8. Ref:2111321: Iwaasa H, Takagi T, Shikama K (1990) Protozoan hemoglobin from Tetrahymena pyriformis. Isolation, characterization, and amino acid sequence. The Journal of biological chemistry 265(15):8603-9

Sequences

>TTHERM_00535150(coding)
ATGAACAAATAGCCTACTGTTTTTGAAAAGCTTGGAGGATAGGCAGCTATGCATGCAGCT
GTTCCCCTTTTCTACAAGAAAGTCTTAGCAGATGATAGAGTCAAACATTACTTTAAAAAC
ACTAATATGGAACACCAAGCTAAGTAATAGGAAGATTTTCTTACTATGCTTTTAGGAGGA
CCCAATCATTATAAAGGAAAAAACATGGCTGAAGCTCATAAAGGTATGAACCTTTAAAAC
TCTCACTTTGACGCTATCATTGAGAATCTTGCCGCCACACTTAAAGAATTAGGAGTTAGC
GATTAAATTATTGGTGAAGCAGCCAAGGTCATTGAACACACTCGTAAAGACTGTCTTGGA
AAGTGA


>TTHERM_00535150(protein)
MNKQPTVFEKLGGQAAMHAAVPLFYKKVLADDRVKHYFKNTNMEHQAKQQEDFLTMLLGG
PNHYKGKNMAEAHKGMNLQNSHFDAIIENLAATLKELGVSDQIIGEAAKVIEHTRKDCLG
K


>TTHERM_00535150(gene)
ATGAACAAATAGCCTACTGTTTTTGAAAAGCTTGGAGGATAGGCAGCTATGCATGCAGCT
GTTCCCCTTTTCTACAAGAAAGTCTTAGCAGATGATAGAGTCAAACATTACTTTAAAAAC
ACTAATATGGAACACCAAGCTAAGTAATAGGAAGATTTTCTTACTATGCTTTTAGGAGGA
CCCAATCATTATAAAGGAAAAAACATGGCTGAAGCTCATAAAGGTATGAACCTTTAAAAC
TCTCACTTTGACGCTATCATTGAGAATCTTGCCGCCACACTTAAAGAATTAGGAGTTAGC
GATTAAATTATTGGTGAAGCAGCCAAGGTCATTGAACACACTCGTAAAGACTGTCTTGGA
AAGTGA