Identifiers and Description

Gene Model Identifier

TTHERM_01169510

Standard Name

HEH2

Aliases

PreTt08260 | 262.m00035 | 3804.m00139

Description

cyclic nucleotide-binding domain containing protein; protein of unknown function; localizes to basal bodies; expressed during vegetative growth; homolog of human disease gene KIAA1279, implicated in nervous system development and Goldberg-Shprintzen syndrome; no homolog in S. cerevisiae

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_01169510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20340.19.997093137033517e-262cyclic nucleotide-binding doma
in-containing protein (1138 aa
)
OxytrichaContig6878.0.g465.997739233660418e-28Cyclic nucleotide-binding doma
in
Stentor CoeruleusSteCoe_92246.305116760146989e-16
SGDYIL033C0.0000000020002373268528243BCY1 Regulatory subunit of the
cyclic AMP-dependent protein
kinase (PKA), a component of a
signaling pathway that contro
ls a variety of cellular proce
sses, including metabolism, ce
ll cycle, stress response, sta
tionary phase, and sporulation
WormBaseWBGene000011730.0000000039998859049333245locus:egl-4 cGMP-dependent p
rotein kinase egl-4 status:C
onfirmed UniProt:O76360 pr
otein_id:CCD71859.1

General Information

Paragraph NoGene NameParagraph Text
6HEH2HEH2 is expressed during vegetative growth of T. thermophila and its protein product has been localized to basal bodies. Interestingly, its protein product was found to have high sequence similarity to the human disease gene KIAA1279. Human KIAA1279 was also found to have homologs in fruit fly, frog, rat, mouse, bee, chicken, and Japanese puffer fish, but none in Saccharomyces cerevisiae. Although the function of KIAA1279 is not yet known, evidence suggests that KIAA1279 is important in the development of the enteric and central nervous system (CNS). KIAA1279 was expressed in different parts of the adult CNS, and mutations in KIAA1279 were associated with Goldberg-Shprintzen syndrome (OMIM).
7HEH2HEH2 appears to be located on the right arm of micronuclear chromosome 2 based on mapping REP6, a locus upstream of HEH2.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01169510(coding)
ATGAGTGTATAATAGGATAGACTGAATTAAATTATTGAAATTTTAAAAACTCCTTCATCC
CTTAGAGCCGAAGTATAGATAAGTTTCTTGTAGCAAGAGACAAATCATATAGGTCTATTC
AAATAATACAAGGAAGAAGATGGAGATGATGAGCTTTAGAGGCTTTGTTGTATGTATATG
AAGTATGAATATCAATCAAAAGATTAAACTCTATTCAACATAGATGATTTTGGTACCAAG
TTCTATATCATATTATCAGGAAAGGTAGGTGTTTATATTCGCATGCCTAAACAAAAAAGG
TTAGAATTATTTTAGGAATAAAATAACTAAAATAAAGCACATGAGCCAGATCCTTTACAA
ATGGTAAAGGAATTAAGAATGGGAGATTCATTTGGAGAGCTAGCCCTTCTTAAAAATAGT
AAAAGATTAGCTACTATTATATGCAAGGAAGATTGTCATTTTGGTGTCATTGATAAAAAA
ATTTTTAACTTAGCACTCAAAGAAAAGGAAGAAGAAAAACTAAATATTTAAATGAGATTC
TTAGCTAATTCTCCTTTGTTTAGTAGATTGCCAAAAAACACTATTAAGCATCTTCATATG
AATGCGTTTTATGTATAGTACTAAAAAGGTCAACCTGTTTACTTAGAAGGACAAAACTCC
AACTCTTGCTTTGTAATCAAAAGTGGAGAGTTTACTATATATAAAACTATTCAACATGTT
ATGAAGACTCATGAAAAAAAAAACTAATATTTGACAGGTGGAGAGTAAAAAAATTTAGAT
ATTAAAATAAGTGTTTTAGGTAAAGGTGAACTTTTTGGTGAAATTGAATTGATATAAGGA
GATTCACGCTGCACTAGTGCTTTTTGTTCAAGCTTAGATGGAGGAGAGTTAATGATTATT
AACAGGACTGATTTAGAAAATAAAGTTTTATGTGAAGAGGAATATATGCAATAGTTTTAA
AATTATATTAAAATGAAAAAGGAATAGCTAAAAAAGAGAATAGAAGGGATTAAAAATTAG
CTACACAAATACCAAACTTATAGGTTTATGACAAGCGCGTTAAAAATTCATGAAGTAGAT
GTTTGTGAGAAAATAAAAAATAAAGAGCTAAATTACTCAATTGATGTTTTAGATGATGTT
ATTCAGAGTTAAACTGATAAAAATGATGATGATGAAGTAGGAATTTTATCAGCCTAAAAG
TCTTCCAAATTAAAGTAGCTATAACAAGTTTAGAAATATAAACCGAAGTCTAAATCTTCA
ATTAATATTTTGAGCAACACTAATTTAAAATTTTAGAATAATTAGAGTTAAACAAGTCTA
CTAAATTTGGCATCAATAAATGATTTAGCTAATCATGAAGAAAATTCATAATTAAAATCA
TAAAACTCACAATAATAAATCACATAACCTTCTTCACAAGAAAAGTTAAATATAAACAGT
TCTCAGTAAATAAATAATTTTGCTCCTGTGGAAGATAAGAAAATCAATGAAGTAACTGCT
CATATCACTAAAAACTCAAAGGAATAGTTTATGAATAAATGGTTTAAATATGGAGAAGGA
GAAGAAGGTCCATAATAAAGTGAAAATAAATCTAAAAAATAAAAATTATTGAGAGTAGAG
CTGAATTCTTACACTGAATTAAAAAATAGCATCAGAAAAAAAACAGCTATTGCCTTAAGT
AAGCAGTATCGCCTTCCTTATGAAAAATTTATGTATGCTGGAAGCATGTATGACATAAGT
TAAAGCGAAGATTGGATGAAATAATAACAAATGTAACCTTAGTAATAACCAGATACAATT
AACAGGAAGACAATATCTTCTTTATCAAAATTAAGAGTTTAGACATAAGCAACACTAAAT
CATATCTAAACATGCAGACATATGAGCTAAACTGATAATTTCTAAGTAGAAAATTAGTCT
TCTATTCATAAGATTAAGAGTTTAGCATGTTTAGATGCCAAATAAAATCTGAATAATATA
AAATAATAATAAAAACCTGTAATTAAAGAGGATTTTTAACACCTAAAAAGTATCTAGTAA
TTTAGCCTACCTGATGAATAAGCTAAAAACAACTTTTTTAATTCTATTTAAAGAATTTAA
AGCAGTGTCAGCTTAAAATCTTAGGATAGCAAAAATTGGATTAGCAAGTAATAAAAAGAA
AATGATAATTTTAAATCAGAGCTATTGGACAAGCTTTAACAATTTAAATAACATTAATAA
CATTAATAATCATAAAATGATATTCCAAATTTAAAAAAATAAAGTTCAAAAAGTCCAAAA
AAAGACACTGATTTAATTGAAGATGTAAATTTAATGAAGAGCATAGAAGATCATTATAAT
AATAGTCTAACAGAAGAGGGTAGCAAAAAGTACTAAAAGAAACTAAAAAACATTTTAAAG
CTTGATATTCAGCATGAATCTTCTGATAATTCCAGGACAAGCACATCAAATCTCAATACT
CCAAAATTAATTTAAAGCAAAAAAGCTAGCTAAGCATCTCTATTTAATATGAGCTCTTCT
ACAAATTTAAAATCCTAACAAAACTTAGACAATAAGTCCTAGTTTAGTAGTATACCTCTA
AAGAATGCTGAAATTCTTTTTGAAAAATAAGGTAAAAAATTATAAAAAAAGCAACATCTA
AGACTTCATGAAAATAAAGACTCACCTCTTAAGTTTCAATTTTCATAATCCACAAGACAC
TCAATGGCAACAAATTATTTTTAACCAAAAAATTTCGTTGAAGATTAAAACTAACTCCCT
TATTGGGTATAACCACTTAGCACCCAGAATAGTGATTAATAGCAATACTCTAAAAATTAA
ATAATTGATTTTAATAATTAAAATAATTAATCTCTCTCTTAAACATTATCTCCTTAAAAT
TAGAAATAAAAATAATATAAAATGCAATTATCTTCATACTTTAAACCTAAAAATATAAAA
AGTGAATTTGGAGAAGATTTAGAAAAAGAAACATCTTTAATTGATAAGCAATTATCCAAA
GAATAAAATTAATTAACTCTATCTCAGAATAAATAAAAATCCTTCATTTACAAAAACAAC
TCCTCTGCTCATGAGATGAATTAAATTATTTCTATAAAATCCGTAAATAATTTGTCTGAC
TTAAATAATAGAGCAATTTCGTCAGAGAGATAATTTAGATAAAAATAATAAACAAATGGA
AGCAGCAGCTAAAATATATTTTATAAAACATTTCATTAAAATAAAAAAATACTTAAAAAC
ATAGCACCCTACAATAACAAAAAACAAACTTTAGAACAACCTGCAATTTATAAATTTCAA
TAAGATTCTCCTTTAAAAGTTAAAAAATATTAATAACTACTATAACCTTAACAATAGCAA
TACAATTTACTAAATTAAATTCTTTCTACTCCAAAAATTACTAATAACTCTTGA


>TTHERM_01169510(protein)
MSVQQDRLNQIIEILKTPSSLRAEVQISFLQQETNHIGLFKQYKEEDGDDELQRLCCMYM
KYEYQSKDQTLFNIDDFGTKFYIILSGKVGVYIRMPKQKRLELFQEQNNQNKAHEPDPLQ
MVKELRMGDSFGELALLKNSKRLATIICKEDCHFGVIDKKIFNLALKEKEEEKLNIQMRF
LANSPLFSRLPKNTIKHLHMNAFYVQYQKGQPVYLEGQNSNSCFVIKSGEFTIYKTIQHV
MKTHEKKNQYLTGGEQKNLDIKISVLGKGELFGEIELIQGDSRCTSAFCSSLDGGELMII
NRTDLENKVLCEEEYMQQFQNYIKMKKEQLKKRIEGIKNQLHKYQTYRFMTSALKIHEVD
VCEKIKNKELNYSIDVLDDVIQSQTDKNDDDEVGILSAQKSSKLKQLQQVQKYKPKSKSS
INILSNTNLKFQNNQSQTSLLNLASINDLANHEENSQLKSQNSQQQITQPSSQEKLNINS
SQQINNFAPVEDKKINEVTAHITKNSKEQFMNKWFKYGEGEEGPQQSENKSKKQKLLRVE
LNSYTELKNSIRKKTAIALSKQYRLPYEKFMYAGSMYDISQSEDWMKQQQMQPQQQPDTI
NRKTISSLSKLRVQTQATLNHIQTCRHMSQTDNFQVENQSSIHKIKSLACLDAKQNLNNI
KQQQKPVIKEDFQHLKSIQQFSLPDEQAKNNFFNSIQRIQSSVSLKSQDSKNWISKQQKE
NDNFKSELLDKLQQFKQHQQHQQSQNDIPNLKKQSSKSPKKDTDLIEDVNLMKSIEDHYN
NSLTEEGSKKYQKKLKNILKLDIQHESSDNSRTSTSNLNTPKLIQSKKASQASLFNMSSS
TNLKSQQNLDNKSQFSSIPLKNAEILFEKQGKKLQKKQHLRLHENKDSPLKFQFSQSTRH
SMATNYFQPKNFVEDQNQLPYWVQPLSTQNSDQQQYSKNQIIDFNNQNNQSLSQTLSPQN
QKQKQYKMQLSSYFKPKNIKSEFGEDLEKETSLIDKQLSKEQNQLTLSQNKQKSFIYKNN
SSAHEMNQIISIKSVNNLSDLNNRAISSERQFRQKQQTNGSSSQNIFYKTFHQNKKILKN
IAPYNNKKQTLEQPAIYKFQQDSPLKVKKYQQLLQPQQQQYNLLNQILSTPKITNNS


>TTHERM_01169510(gene)
GTTTTTATTAATCACATTTATTTGATAAAAATTTAATATAACAAATTTGCTCAAAAACTA
ACAGTAAATTAAACTCTTTGGTAAAAGGATTCAAAGCATTGTGGTGAGCTAAAATTTATA
TAAGAACAACTTTCGAATTTTTATAAAATGAGTGTATAATAGGATAGACTGAATGTAATT
TCATATGTTTTTTCTTTGAAAATAAATGTTTTTCATCAAATATGATGAAAGTTATTTTGT
ATCATTTTGCTTATTTTAGTTATGATTATAATTAGTAAATTATTGAAATTTTAAAAACTC
CTTCATCCCTTAGAGCCGAAGTATAGATAAGTTTCTTGTAGCAAGAGACAAATCATATAG
GTCTATTCAAATAATACAAGGAAGAAGATGGAGATGATGAGCTTTAGAGGCTTTGTTGTA
TGTATATGAAGTATGAATATCAATCAAAAGATTAAACTCTATTCAACATAGGTAATGATT
GCTTAAATTATGTTTAAACATTAAATGTTTAAGCTTTTATTATTTTTAGTTGCTCATAAA
TTTTAAATATAATATTTTTATAGATGATTTTGGTACCAAGTTCTATATCATATTATCAGG
AAAGGTAGGTGTTTATATTCGCATGCCTAAACAAAAAAGGTTAGAATTATTTTAGGAATA
AAATAACTAAAATAAAGCACATGAGCCAGATCCTTTACAAATGGTAAAGGAATTAAGAAT
GGGAGATTCATTTGGAGAGCTAGCCCTTCTTAAAAATAGTAAAAGATTAGCTACTATTAT
ATGCAAGGAAGATTGTCATTTTGGTGTCATTGATAAAAAAATTTTTAACTTAGCACTCAA
AGAAAAGGAAGAAGAAAAACTAAATATTTAAATGAGATTCTTAGCTAATTCTCCTTTGTT
TAGTAGATTGCCAAAAAACACTATTAAGCATCTTCATATGAATGCGTTTTATGTATAGTA
CTAAAAAGGTCAACCTGTTTACTTAGAAGGACAAAACTCCAACTCTTGCTTTGTAATCAA
AAGTGGAGAGTTTACTGTAATAATTTTATTACTTCAGTATTTAATCTTAAAAATAAATTA
TTTTTAAGATTTTTATAAAAAAAAAGTAGAAATAATATCAAATATTTATATAAAACTTAT
TAAAAATACAGATATATAAAACTATTCAACATGTTATGAAGACTCATGAAAAAAAAAACT
AATATTTGACAGGTGGAGAGTAAAAAAATTTAGATATTAAAGTAATTCAATTATTTTCTA
TTAAATATATTTATAATTTATTTTTTTTAAATGAAAATAAAAGATAAGTGTTTTAGGTAA
AGGTGAACTTTTTGGTGAAATTGAATTGATATAAGGAGATTCACGCTGCACTAGTGCTTT
TTGTTCAAGCTTAGATGGAGGAGAGTTAATGATTATTAACAGGACTGATTTAGAAAATAA
AGTTTTATGTGAAGAGGAATATATGCAATAGTTTTAAAATTATATTAAAATGAAAAAGGA
ATAGCTAAAAAAGAGAATAGAAGGGATTAAAAATTAGCTACACAAATACCAAACTTATAG
GTTTATGACAAGCGCGTTAAAAATTCATGAAGTAGATGTTTGTGAGAAAATAAAAAATAA
AGAGCTAAATTACTCAATTGATGTTTTAGATGATGTTATTCAGAGTTAAACTGATAAAAA
TGATGATGATGAAGTAGGAATTTTATCAGCCTAAAAGTCTTCCAAATTAAAGTAGCTATA
ACAAGTTTAGAAATATAAACCGAAGTCTAAATCTTCAATTAATATTTTGAGCAACACTAA
TTTAAAATTTTAGAATAATTAGAGTTAAACAAGTCTACTAAATTTGGCATCAATAAATGA
TTTAGCTAATCATGAAGAAAATTCATAATTAAAATCATAAAACTCACAATAATAAATCAC
ATAACCTTCTTCACAAGAAAAGTTAAATATAAACAGTTCTCAGTAAATAAATAATTTTGC
TCCTGTGGAAGATAAGAAAATCAATGAAGTAACTGCTCATATCACTAAAAACTCAAAGGA
ATAGTTTATGAATAAATGGTTTAAATATGGAGAAGGAGAAGAAGGTCCATAATAAAGTGA
AAATAAATCTAAAAAATAAAAATTATTGAGAGTAGAGCTGAATTCTTACACTGAATTAAA
AAATAGCATCAGAAAAAAAACAGCTATTGCCTTAAGTAAGCAGTATCGCCTTCCTTATGA
AAAATTTATGTATGCTGGAAGCATGTATGACATAAGTTAAAGCGAAGATTGGATGAAATA
ATAACAAATGTAACCTTAGTAATAACCAGATACAATTAACAGGAAGACAATATCTTCTTT
ATCAAAATTAAGAGTTTAGACATAAGCAACACTAAATCATATCTAAACATGCAGACATAT
GAGCTAAACTGATAATTTCTAAGTAGAAAATTAGTCTTCTATTCATAAGATTAAGAGTTT
AGCATGTTTAGATGCCAAATAAAATCTGAATAATATAAAATAATAATAAAAACCTGTAAT
TAAAGAGGATTTTTAACACCTAAAAAGTATCTAGTAATTTAGCCTACCTGATGAATAAGC
TAAAAACAACTTTTTTAATTCTATTTAAAGAATTTAAAGCAGTGTCAGCTTAAAATCTTA
GGATAGCAAAAATTGGATTAGCAAGTAATAAAAAGAAAATGATAATTTTAAATCAGAGCT
ATTGGACAAGCTTTAACAATTTAAATAACATTAATAACATTAATAATCATAAAATGATAT
TCCAAATTTAAAAAAATAAAGTTCAAAAAGTCCAAAAAAAGACACTGATTTAATTGAAGA
TGTAAATTTAATGAAGAGCATAGAAGATCATTATAATAATAGTCTAACAGAAGAGGGTAG
CAAAAAGTACTAAAAGAAACTAAAAAACATTTTAAAGCTTGATATTCAGCATGAATCTTC
TGATAATTCCAGGACAAGCACATCAAATCTCAATACTCCAAAATTAATTTAAAGCAAAAA
AGCTAGCTAAGCATCTCTATTTAATATGAGCTCTTCTACAAATTTAAAATCCTAACAAAA
CTTAGACAATAAGTCCTAGTTTAGTAGTATACCTCTAAAGAATGCTGAAATTCTTTTTGA
AAAATAAGGTAAAAAATTATAAAAAAAGCAACATCTAAGACTTCATGAAAATAAAGACTC
ACCTCTTAAGTTTCAATTTTCATAATCCACAAGACACTCAATGGCAACAAATTATTTTTA
ACCAAAAAATTTCGTTGAAGATTAAAACTAACTCCCTTATTGGGTATAACCACTTAGCAC
CCAGAATAGTGATTAATAGCAATACTCTAAAAATTAAATAATTGATTTTAATAATTAAAA
TAATTAATCTCTCTCTTAAACATTATCTCCTTAAAATTAGAAATAAAAATAATATAAAAT
GCAATTATCTTCATACTTTAAACCTAAAAATATAAAAAGTGAATTTGGAGAAGATTTAGA
AAAAGAAACATCTTTAATTGATAAGCAATTATCCAAAGAATAAAATTAATTAACTCTATC
TCAGAATAAATAAAAATCCTTCATTTACAAAAACAACTCCTCTGCTCATGAGATGAATTA
AATTATTTCTATAAAATCCGTAAATAATTTGTCTGACTTAAATAATAGAGCAATTTCGTC
AGAGAGATAATTTAGATAAAAATAATAAACAAATGGAAGCAGCAGCTAAAATATATTTTA
TAAAACATTTCATTAAAATAAAAAAATACTTAAAAACATAGCACCCTACAATAACAAAAA
ACAAACTTTAGAACAACCTGCAATTTATAAATTTCAATAAGATTCTCCTTTAAAAGTTAA
AAAATATTAATAACTACTATAACCTTAACAATAGCAATACAATTTACTAAATTAAATTCT
TTCTACTCCAAAAATTACTAATAACTCTTGA