Identifiers and Description

Gene Model Identifier

TTHERM_00221180

Standard Name

HEH1

Aliases

PreTt22446 | 18.m00472 | 3701.m00229

Description

Similar to Homo sapiens sequence KIAA1033; expressed in conjugating and vegetative cells; essential for vegetative growth

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03789 ) ELK domain
  • ( PF07453 ) NUMOD1 domain
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR01257 ) rim ABC transporter
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF07554 ) Uncharacterised Sugar-binding Domain
  • ( PF07115 ) Protein of unknown function (DUF1371)
  • ( PF00376 ) transcriptional regulator, MerR family
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF04895 ) Archaeal protein of unknown function
  • ( PF03095 ) Phosphotyrosyl phosphate activator (PTPA) protein
  • ( PF00479 ) Glucose-6-phosphate dehydrogenase, NAD binding domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00221180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_130250
Tetrahymena borealisEI9_06798.19.997093137033517e-262hypothetical protein (1187 aa)
OxytrichaContig11125.0.g674.000685850263616e-170hypothetical protein
DictyBaseDDB_G02833555.999579683817102e-155swip on chromosome: 4 position
559359 to 563272
WormBaseWBGene000131677.999528511121947e-28status:Partially_confirmed U
niProt:Q9NA99 protein_id:CAB
61092.4

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00221180(coding)
ATGAGAAGCTAAGCCCCGTAAAGTATAAGAAGCTCTAACCCTTTTAGCTCAGATGATGAC
ATATCTGACGATGAGGAAAAACAATAGGACTATATTTAGACAACTAAGCCATATGAAGAA
CATTTTGAGAAGTTCAGTTAGCAATTCAACAATTATATTCAAAAGACAAAAGATTTAGAT
TAAAAATATCAAATTCCTCTTGGAGATACACCCTTTAACATTCTCCATTTAAATGTGAAT
CAATAAGTTCAAAAGTAAGGTTTATTCGATGTAAACCAAACAGACAACCCATTTTATGAC
AAAGTTTCAGCTACTTTTACTTACTTGGATACAGAAATCGGAAAGATTACAGAAGTCTTT
GAAAGCAAAATACTTAATGTGATTTCTATGTATGGTGAAAGAGCTTTAGATGATTTCTAA
GATGAAGAAGAGTTTCCTTTGCTTGATGGTTAAGCTGAATTTGAAATTTCAAAGCTATCT
CCAATTTTTAAATAAAGTTTAGATTTGATAAAGAAAATAATGGGCATTCTCCACAATTTA
ATAAATTAGTTAAACATAATTTACTACAAAAAGAATGATTTGCATAAAAATATATTCAAA
AATGTTGAGTTGAATAGTGTTTTCTAGACAATCGGCAAGGGTTTATCAGTTGTCTATGTT
CTTGACTGTGCGATTAATTAAAACAAGAAAATACGTGACCATTGGAATGTTTACAAACGT
ATGATTAAAATTATTTAAACAGAACCATCAAAATTTGGAAGTGACCCTAAAACTGTTAAA
AGATTTGAAAAAAATATCGCACGTCTAGATAAAACTGTACTCAGTGGTGCTTGTGTTTAG
GCAGTGCTTGAACAAAATTATGATGCAAACAAGAGCTTTACATCCGATTAGCTTAAATAA
TAAAATTTGTGTCTTTTAGCTAAAAACAAAGATTTAATTGAGCTATTTGAAAATTATTTC
AAATAGTAGGTTGTATTTTATAATGATATATTAGACACTACTTCTGAAGTGTAGGAAAGA
AAAGACTTGCTTTACTTCTTATGCACATACGCTTTCTTCCGTAAAGTTTTCCCAGAAGAG
TAAGATAAAAAGATATATAAATCTCTTTGGACATTATAGAAGAAGTCACCTGTTCTTGAA
GGACACACTCACATCTTCTGTTACGTTTATAAGTTTTTGAGATATGTTTGTCCTCTCAGT
AAGAGTACTACTCTTGACCCTAAAGAGCCTGAATAATTCACTAAACTATATGTGCAAGAT
TTGGATATTTAAATTCCAAAAAAAATAAATACTTTTTATGAGGACTTTTGCTATTGGATA
TCTCGTATGGAGTCAATATTAACATCAAACACTGCTTTAGCAACAGGTGATAAAAGTAAA
AGAGATAGATCCATCAAGATTGTAGAGGAATACACTTCCTACAGAGTTAGATTATTGATA
AAAGCATTATAAATGGCAAGCTAGATAAAGTAAATGATTACAACAAATTTGATGCTTCAT
ATCAATGAAGGAATAGGTTTTACTCCATAACTAATTAAGTATGTAGTAAAAGGCATAGTT
ATGCTTAAAGCAATTGAATCAGTATACATATCAAAAATAGAAGCCTTTTAACCACACATG
CTACTCAAAACTTTAGTAAAGCAACTCCTCTTGATTTTAGGTGCTACTTATGAGAAATTA
ACTAAAGCTGACTATAAATAAAAGAAACCCCTTTATAATGAATTTAGAGCAGCTATATAA
AATGTCATAAAAAATTTACGTGGGCCAATAACTTCCTTAAAGATCTCAACAATGGAATTT
GCCTTAAATTTTATTATTTCAAACTACATTACAGAGAAAAAAGAAGGACAAGATATTAAA
TTTATATTTTGGAAAATAAAAACAGTTTCTTAATTCTAATATAATATTTCCAAAGCAACA
AACTGTTCTTTCCTATTCTGGTGCAAAGATATACTTCCTTTGGCAATTAAATAATTCTTT
GAAAATCCAAGCCAGTCTAAAAGATTAATTTATCTATCTTAAGCTATCAGTGATACCCTT
CCTATTGTTAAAGCAACTCTTCATCTATAAAATCCTTTATATATGTATGAGACTTTTAAA
GAAGAAGTTATCACTACCTTCAAAGATGAATACTTAACCCCTCTTACTAGATAAATTGAA
GACTTTTTGAGAATTCAAATTCATGCTATGCTTATTGATAAGGTTGTTGGAAAAAATCCA
TTTAAAGATGAAATGAATAATATTAAAAAACTACTCGAATTAGAGTAGATATAATTCTTT
GATGTTATAATTGATATTAAGAAGGAAATTTAGAATTAGCTGAATGAAAAATTCTACAAT
TTAAATGTCTTGAATATGCATGATATGGAAACTTATGAGTAAATGAGAGTCCTAGCCAAA
TTTTACTTTGATGTTAATTTGATCAATGTTTACATTCCAAGTTAAACAATAGAATAAGGA
TAGCTTGATATTTTACAAATTTTAAGAAATATCCCCACATTCGTAGATACTTATACTTAT
AATTTGCATAATTAAACGTTTACTCAGATTACTACTGAGAGTAAATTAGTACAAACAATT
GGAATTTAGCAGATTTCTGATTCAATTAGAACTCATGGTCTTGGTATTTTAAATACTACT
GTTAATTCAATCTTTAAATATGTTGCCAAAAAAATTGAAATTCTCAGTAATTTACTATAC
GATGAGCTTATCCTTTAAAATTTAATCAGAGAAGAAAAGTGGTTTTAAGAAAATAAAATG
TAAATTGATGGATACTACCCTTATGAAAGAGCTAAAAAGTTATCGAGCACTCTCAAAAGA
CTAGGTGTATCTAAAGAAGGAAATACTTATCTTGATTAGTTTAGAATATTTATAACATAA
ATTGGTAATGCATTAGGTTTTATAAGATTGTTGAGATCAGCAAGTTTAAACTATTGTTCA
AAGAGCATTGAATTTTTACCATATCAAATTGATTCAGAAGATTCATTCTTAGAATTAGCT
AAATAAGCAATGAGTGGTTAAGCAACTACTAAAGCAGCTAAAGAATTAGATGACATTTTA
CTCTAACTTAAGAGTTATTTTTCTTCTGGAACTGATTATTTAAAGAGAATAGTATCAACA
ATGAGCAAATATGCTTAAAGTGAATCTCAAAATCATTTCACTAACTTCCACATTTTAGTT
CCTTGCCTTACATTAAATTATGTCACTCATGCATTAATATGCAAAGATAAAATACCAATT
AAAAATAATGTGAATGCCTTCTTATGTAATGATGGTTTTATAATCGGTATTGCTTATATC
TTAAAACTATACAATCTTGAAGAAAAATTCCATTTAATTCACTGGTAAGAAGAAGTAAGA
AAGGTTTACAAAGAAGAATTGGAATCTATTAAAGAGATTTCTTAGGCTGATACTACCTAA
ATCTCTACTCATAGGCTTTAATAGATGCAACTGGAGAACGGTCTTTCAATTAAAAAATTA
GAAAGCAACTTGTATGAGTATAATATGTTCTTCAACACTTTCTAAGCTTGCAAAATTTTA
TTTAGAGAAGATCCTGTTTGA


>TTHERM_00221180(protein)
MRSQAPQSIRSSNPFSSDDDISDDEEKQQDYIQTTKPYEEHFEKFSQQFNNYIQKTKDLD
QKYQIPLGDTPFNILHLNVNQQVQKQGLFDVNQTDNPFYDKVSATFTYLDTEIGKITEVF
ESKILNVISMYGERALDDFQDEEEFPLLDGQAEFEISKLSPIFKQSLDLIKKIMGILHNL
INQLNIIYYKKNDLHKNIFKNVELNSVFQTIGKGLSVVYVLDCAINQNKKIRDHWNVYKR
MIKIIQTEPSKFGSDPKTVKRFEKNIARLDKTVLSGACVQAVLEQNYDANKSFTSDQLKQ
QNLCLLAKNKDLIELFENYFKQQVVFYNDILDTTSEVQERKDLLYFLCTYAFFRKVFPEE
QDKKIYKSLWTLQKKSPVLEGHTHIFCYVYKFLRYVCPLSKSTTLDPKEPEQFTKLYVQD
LDIQIPKKINTFYEDFCYWISRMESILTSNTALATGDKSKRDRSIKIVEEYTSYRVRLLI
KALQMASQIKQMITTNLMLHINEGIGFTPQLIKYVVKGIVMLKAIESVYISKIEAFQPHM
LLKTLVKQLLLILGATYEKLTKADYKQKKPLYNEFRAAIQNVIKNLRGPITSLKISTMEF
ALNFIISNYITEKKEGQDIKFIFWKIKTVSQFQYNISKATNCSFLFWCKDILPLAIKQFF
ENPSQSKRLIYLSQAISDTLPIVKATLHLQNPLYMYETFKEEVITTFKDEYLTPLTRQIE
DFLRIQIHAMLIDKVVGKNPFKDEMNNIKKLLELEQIQFFDVIIDIKKEIQNQLNEKFYN
LNVLNMHDMETYEQMRVLAKFYFDVNLINVYIPSQTIEQGQLDILQILRNIPTFVDTYTY
NLHNQTFTQITTESKLVQTIGIQQISDSIRTHGLGILNTTVNSIFKYVAKKIEILSNLLY
DELILQNLIREEKWFQENKMQIDGYYPYERAKKLSSTLKRLGVSKEGNTYLDQFRIFITQ
IGNALGFIRLLRSASLNYCSKSIEFLPYQIDSEDSFLELAKQAMSGQATTKAAKELDDIL
LQLKSYFSSGTDYLKRIVSTMSKYAQSESQNHFTNFHILVPCLTLNYVTHALICKDKIPI
KNNVNAFLCNDGFIIGIAYILKLYNLEEKFHLIHWQEEVRKVYKEELESIKEISQADTTQ
ISTHRLQQMQLENGLSIKKLESNLYEYNMFFNTFQACKILFREDPV


>TTHERM_00221180(gene)
ATGAGAAGCTAAGCCCCGTAAAGTATAAGAAGCTCTAACCCTTTTAGCTCAGATGATGAC
ATATCTGACGATGAGGAAAAACAATAGGACTATATTTAGACAAGTACACATTATAAGAAA
TATTAAAAATATTAAATTACATATATTAATCATAATTGCAATGTCTAAAAATATCAACTT
ATAAAATGATTGATATATTTTTTTTATAATATTTTATTCACCTATATCAATTTTGTTAAT
AGCTAAGCCATATGAAGAACATTTTGAGAAGTTCAGTTAGCAATTCAACAATTATATTCA
AAAGACAAAAGATTTAGATTAAAAATATCAAATTCCTCTTGGAGATACACCCTTTAACAT
TCTCCATTTAAATGTGAATGTAAAACCTTACTATTAAATTAAATATTCAAGATAAAATGT
TGCTCAGCATATCAATCAATATCATTTTATTTTATTATTTTATTTATATTAATATAATAT
TCTAAAATAATGATAGCAATAAGTTCAAAAGTAAGGTTTATTCGATGTAAACCAAACAGA
CAACCCATTTTATGACAAAGTTTCAGCTACTTTTACTTACTTGGATACAGAAATCGGAAA
GATTACAGAAGTCGTAATGAATATTGAAGTTTAAAATAAAAAAAGTTTGGCATTTTAGTC
AAAAAATAAAAAAATAAAAGGCAGTCATATTTATTATCAATAATTTAATTCTCTTACCAG
AAATACAAATACTGATATTCAAAATATCTTTTATTATTAATTATAAGATAAAAAATTTTT
AGGAAAGCAAGAGTATTTTAAGGAAAGTCAATAAAATATAAATATTCGCGAATCTATTAA
TAATTGATTGCCAATTAATTATTTGCTTACTTATTTGATAATATTTTAAAGCAAGCAAAT
ATAAATTTGTAAAATTAAAAAAATTGTACAAAAGAATTTCAAAAATAATTTTAAAGATCA
CATAAATATGCATTTAATAATTAAAAATAACTAATGATTTATTTTTTTGATAAAAAATAA
GTTTGAAAGCAAAATACTTAATGTGATTTCTATGTATGGTGAAAGAGCTTTAGATGATTT
CTAAGATGAAGAAGAGTTTCCTTTGCTTGATGGTTAAGCTGAATTTGAAATTTCAAAGCT
ATCTCCAATTTTTAAATAAGTAAAGTATTTTTAAAATTTGAAATTTTGTTAAATATATTA
TGGTTAAATGAATAGAGTTTAGATTTGATAAAGAAAATAATGGGCATTCTCCACAATTTA
ATAAATTAGTTAAACATAATTTACTACAAAAAGAATGATTTGCATAAAAATATATTCAAA
AATGTTGAGTTGAATAGTGTTTTCTAGACAATCGGCAAGGGTTTATCAGTTGTCTATGTT
CTTGACTGTGCGATTAATTAAAACAAGAAAATACGTGACCATTGGAATGTTTACAAACGT
ATGATTAAAATTATTTAAACAGAACCATCAAAATTTGGAAGTGACCCTAAAACTGTTAAA
AGATTTGAAAAAAATATCGCACGTCTAGATAAAACTGTACTCAGTGGTGCTTGTGTTTAG
GCAGTGCTTGAACAAAATTATGATGCAAACAAGAGCTTTACATCCGATTAGCTTAAATAA
TAAAATTTGTGTCTTTTAGCTAAAAACAAAGATTTAATTGAGCTATTTGAAAATTATTTC
AAATAGTAGGTTGTATTTTATAATGATATATTAGACACTACTTCTGAAGTGTAGGAAAGA
AAAGACTTGCTTTACTTCTTATGCACATACGCTTTCTTCCGTAAAGTTTTCCCAGAAGAG
TAAGATAAAAAGATATATAAATCTCTTTGGACATTATAGAAGAAGTCACCTGTTCTTGAA
GGACACACTCACATCTTCTGTTACGTTTATAAGTTTTTGAGATATGTTTGTCCTCTCAGT
AAGAGTACTACTCTTGACCCTAAAGAGCCTGAATAATTCACTAAACTATATGTGCAAGAT
TTGGATATTTAAATTCCAAAAAAAATAAATACTTTTTATGAGGACTTTTGCTATTGGATA
TCTCGTATGGAGTCAATATTAACATCAAACACTGCTTTAGCAACAGGTGATAAAAGTAAA
AGAGATAGATCCATCAAGATTGTAGAGGAATACACTTCCTACAGAGTTAGATTATTGATA
AAAGCGTACATTCTTTTATTTAAATTAAACTAGAAGTTTTTTTTATTTTATTTAACTTAT
TTCATGTTAAAAAAGATTATAAATGGCAAGCTAGATAAAGTAAATGATTACAACAAATTT
GATGCTTCATATCAATGAAGGAATAGGTTTTACTCCATAACTAATTAAGTATGTAGTAAA
AGGCATAGTTATGCTTAAAGCAATTGAATCAGTATACATATCAAAAATAGAAGCCTTTTA
ACCACACATGCTACTCAAAACTTTAGTAAAGCAACTCCTCTTGATTTTAGGTGCTACTTA
TGAGAAATTAACTAAAGCTGACTATAAATAAAAGAAACCCCTTTATAATGAATTTAGAGC
AGCTATATAAAATGTCATAAAAAATTTACGTGGGCCAATAACTTCCTTAAAGATCTCAAC
AATGGAATTTGCCTTAAATTTTATTATTTCAAACTACATTACAGAGAAAAAAGAAGGACA
AGATATTAAGTAATTTCTACTATTTAGATCTATTTTCAAAAATAACTCTATTTAGATAAT
TATAATACCAATTAATTAATCTACTTTATATAATTCAATCTAACTGAATATAAGTTATTG
ATTGATTTAAAGCTTAACTTTATCTAAATAGAAACTTGATTATAATTTACTCAAATTTTT
AAATCAAAAAATTGAAAATTTAATCATATTAATTTATTTATCTTTTTTTAACAAAATAGA
TTTATATTTTGGAAAATAAAAACAGTTTCTTAATTCTAATATAATATTTCCAAAGCAACA
AACTGTTCTTTCCTATTCTGGTGCAAAGATATACTTCCTTTGGCAATTAAATAATTCTTT
GAAAATCCAAGCCAGTCTAAAAGATTAATTTATCTATCTTAAGCTATCAGTGATACCCTT
CCTATTGTTAAAGCAACTCTTCATCTATAAAATCCTTTATATATGTATGAGACTTTTAAA
GAAGAAGTTATCACTACCTTCAAAGATGTAAAATTTCAATAAAAAAAAGAAGTATTTATT
TATATTCATTTAAAAAATATAGGAATACTTAACCCCTCTTACTAGATAAATTGAAGACTT
TTTGAGAATTCAAATTCATGCTATGCTTATTGATAAGGTTGTTGGAAAAAATCCATTTAA
AGATGAAATGAATAATATTAAAAAACTACTCGAATTAGAGTAGATATAATTCTTTGATGT
TATAATTGATATTAAGAAGGAAATTTAGAATTAGCTGAATGAAAAATTCTACAATTTAAA
TGTCTTGAATATGCATGATATGGAAACTTATGAGTAAATGAGAGTCCTAGCCAAATTTTA
CTTTGATGTTAATTTGATCAATGTTTACATTCCAAGTTAAACAATAGAATAAGGATAGCT
TGATATTTTACAAATTTTAAGAAATATCCCCACATTCGTAGATACTTATACTTATAATTT
GCATAATTAAACGTTTACTCAGATTACTACTGAGAGTAAATTAGTACAAACAATTGGAAT
TTAGCAGATTTCTGATTCAATTAGAACTCATGGTCTTGGTATTTTAAATACTACTGTTAA
TTCAATCTTTAAATATGTTGCCAAGTAAATTTTAGCTTCCTTCAAGAGACATTTAAATAA
ATTTTTATATTTTAAATAGAAAAATTGAAATTCTCAGTAATTTACTATACGATGAGCTTA
TCCTTTAAAATTTAATCAGAGAAGAAAAGTGGTTTTAAGAAAATAAAATGTAAATTGATG
GATACTACCCTTATGAAAGAGCTAAAAAGTTATCGAGCACTCTCAAAAGACTAGGTGTAT
CTAAAGAAGGAAATACTTATCTTGATTAGTTTAGAATATTTATAACATAAATTGGTAATG
CATTAGGGTAATTTTTTTGATTTATTTTATGATAGCATATGTTAAATTTTCCCTCTAATA
TTACTAGTTTTATAAGATTGTTGAGATCAGCAAGTTTAAACTATTGTTCAAAGAGCATTG
AATTTTTACCATATCAAATTGATTCAGAAGATTCATTCTTAGAATTAGCTAAATAAGCAA
TGAGTGGTTAAGCAACTACTAAAGCAGCTAAAGAATTAGATGACATTTTACTCTAACTTA
AGAGTTATTTTTCTTCTGGAACTGATTATTTAAAGAGAATAGTATCAACAATGAGCAAAT
ATGCTTAAAGTGAATCTCAAAATCATTTCACTAACTTCCACATTTTAGTTCCTTGCCTTA
CATTAAATTATGTCACTCATGCATTAATATGCAAAGATAAAATACCAATTAAAAATAATG
TGAATGCCTTCTTATGTGTAATCATAATTAATTATTATATTTAAATGCAAATTTTATTAA
AATTATTTAATATGTTAAAAATTAGAATGATGGTTTTATAATCGGTATTGCTTATATCTT
AAAACTATACAATCTTGAAGAAAAATTCCATTTAATTCACTGGTAAGAAGAAGTAAGAAA
GGTTTACAAAGAAGAATTGGAATCTATTAAAGAGATTTCTTAGGCTGATACTACCTAAAT
CTCTACTCATAGGCTTTAATAGGTAAATGTTAATTAAAAATTAAACCTATTTTTATTTTT
TTTTTATATAAATAGATGCAACTGGAGAACGGTCTTTCAATTAAAAAATTAGAAAGCAAC
TTGTATGAGTATAATATGTTCTTCAACACTTTCTAAGCTTGCAAAATTTTATTTAGAGAA
GATCCTGTTTGA