Identifiers and Description

Gene Model Identifier

TTHERM_00675560

Standard Name

HCF2 (Heterochromatin factor 2)

Aliases

PreTt10997 | 101.m00152

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF09091 ) Centromere binding protein B, DNA

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00675560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14280.12.0008536325002377e-42hypothetical protein (694 aa)
WormBaseWBGene000216790.00006000996057121373status:Confirmed UniProt:Q9N
3P2 protein_id:CCD71726.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00675560(coding)
ATGTATATGAAATCACTAAAAAACAAAATCCATACTAAATACATAGCTAAAAAAAGGCGC
TTTTAAATTTAAAAATTTTATCAGGAATTATTTCTTATCAAAAAGGTGTGTCTGATCACA
AAATAATATCAAACTATTTATCTTGCTACTTAAGATTTTTTAATATTTGATGAAATTTAG
TAAAGGAAAGAATAAAAAGTAGAACTAAATCATTTAATATAGATGCACAGTGAAAAAAAA
GATTTTAAACTTAATTCTGCTGCCACTTCAGATTTATTTTACAATAGACAGTAATTTATT
TAACTCGTTAATGAGCAAATTTAACTTTTGGAGACATCTGTAGATAGTTAGAATCTTAAT
GAGCAGTATAAATTCTTATCTGGTTTCTTAAGAGAGAGTAGTAGCTTAGTTATTTTTTTG
CAGCAACAAATGTAAACTCTTTACAAGTTAAGAATTTATCAATTATCTGCTGTTTCGGTT
GAAAGAAATCAGCTAACTCCACCAAAATATGATTATTTGAGTAATACTGAATGTACATTT
TAAGATTTGTTTAGTAGAAACGAGCAGCTTAAAAGTCAATCTTCCTTTCAAAGGGCTTTT
GATAAATCTGTTTAGTAAAGCGATTCTAATTTTTACATTTACCCGAAGCAACTAGCTGAA
GAAAATAATAGTTAAAACAATAATAAGTATTTTGATTATATGAACAATATTACTCCTCAA
CAATATTAATAAAAGTATTAACTTTACAACAACTCTTCTTTTTTTAATGATAAAAACGAA
GATTTATTTCCTGTAAATCTTAGTGAGTCCTTTAAGAAAATTAAGAACTACTCAGATTTT
TTCGATAACCAAAATAACAAGCAATCTACTAACTTTTCTGAATACTTTGATACTAAGAAT
AGATACAGAATACTTAAGCAATAAAACCTTGAGCTAGATTTCATCAAAGTTAAACAACCA
ACCATCACAGATGAGGCTAAAGAAAATTATGTCAGCTAATTTGGCAATTAAAGTTAGGGC
AAGCAAATAAAAATTGTAAAAAAGAATACCTGTAGTAACAATAATTTGGCTATATTTTCT
TCTCCACAGCAAGCGATGGCTCAAGAAGAAAAGATACAGTCTAAGAACTTCTCGTTTGAA
GACATGGATGTTTATGAAGAAAAAAATACAGATAAAAATTATAACTAAAAGTTTTTAAGA
CAAGAAATTCCCGTTTAAGAGTTTTAACTTTTAAATTTGCCTGGTTCTTCTCCCAAGCAG
CAGAATGGTGGCACTCCTTATAAAACATTTAAAGAAAAGTAGCTCTATTAAAAACCAATA
AATTCTAATTAAACCAAACAAATATAGAAATTCAATTAAAATAATAGCTATCTAGACTAT
GATTTTGACATACAAGAAGGAAGTGTTTTAAAAAATTGTTAAAAATTGAATATTTTAAAT
AATTAGGTTACAAATAATTAAAATGAGAAGAAGTCTTTTAACATGGATAATTCTAAATAA
ATTAATGTATTAGGTACTTTGCAAAAAAATATTTAAGAAAATGGCTAAATTGATTCATCT
CAATTTAAGTAAAATCACTACAAAAATGATATTTCAAATACATAAGAAAGGAATACTTAA
AACAATTTGCTTGGAGGAGCTTAAAACATTTTACAGACAAATAATTAATGCAATTTATTG
AATAATTCTAATTAAAAATTAAATATTTAAAATAGTTAAATATCAAAGATTTCTAATAAT
CAATAAAGTAATAAATAAAACTAATAAAGTAATTTAAGTAGTTAATAAGGTCAAGTTTCT
TACAGTTAATAAAGTTCTCACTTAAATACTTAATAAAGCTCAAATGAAAAATAAAATTCT
AATTTATTTTAAGGAAAAATAAGCTAAAAACCACAACGAAAGAAAAAAGAAAGAGCAAAA
AAAATCTTGAAAGCATACTATCAGCAGAACAGCGATGAATCCTTAAGCAGCAATCCAATT
GATAAGAAGAAAAAAATATCTAAAACCAATAACAAGCTTGCTACCTCAATGAGAAGTAAA
ATATAAGAAAATGATAAAATAAAGACAAAATTAAGTAAAAGAGATTCAAATTATGGTGAT
AGTAATTTAGAAGAATCTCTATTTGAAAATGATACTAGCGAAGAAAGCAGCAATTCTGAC
TTATATTATGATTAAGAAAGTGAAAATGATGATAATGATAGCTTAAAGCAAGAGTCAGAT
AAAAGTTTCGATGAAGATTAGTCTTTTTCATACTCAGATGAAGAGAATTTAGACGACAAA
GGTTTTATAGAAACATAGCAAGCAAATAACTCTAGTAAACTGAATTTGACAACAAAATCA
AAAAGAGGGCATTACAAAAAATATTCTGTGAAACTAAAGAAAAAATTGGTTAATCTACTT
CTGGAAGGAGAATAGCCAAAGGATCTCTCTTAAAAATATAATATTCCTATGAAAAATTTA
TAAAGATGGAAAATTTATGGTGCTGAAAGAAGGGAAGGAGGAGGAAGAAAGATCATGGAT
TTAAATATGGAAGTTATTCTTTTAGAGTATTGTATTGATTATACATTAAGAGGAAGGTGT
AGATGTCCTAGAAAATTAATTATGCAAAAAGCAAGAGATTTTACTAAAGAGGCTAATAAG
TTTAAAGGATCAAAAGGTTGGCTTGATAAATACTCTACTAGAACTGGTCTGTCAAAGATA
ATGTCAGAGTATAAACAATTAAAGATTAGTAATGAGAGAGAAATCTTCAAATATGTTAAA
TGTAAATCAATTGAGCATATTAAATAAAAGATAAAATAGGTAAATCCTCTAAACATATTT
ACAAGTTAGCAATACATTAAATTTTTAGAAGGGCAACTTTCTGTTTATTAGAATTTTTGG
GAAATTGAATTACCTTGCTATAAAAACATTTCTAGTTAATATTGGCAGTATTATGAAAAT
AGAAACACAATTTAACTAATTTAAAATAACATCTTTAGTGATGTTATAACTGAATATAAA
AAATTTAATAAGTGTTCTAAATTAAATGACCTTAACTATTACTTTGGTATTCCATCTGAA
TATTTCTTAAAATGTCTTTGCCTTTAAAATTGCTCTGAGAAAAGCAAGCAACCAAACGAT
TAAACAATACAACATTAAAATTTGAAAGAACAGTCTTAGATAGTTTAAGAAGCAAATTCA
GAATATTTAAAGCAGGATCTCATAAAATAAGTAAAAAAAGAAGCAGTTGAAGAGAGAATG
CAAAGCTCAGCAGTTTTGGTAGATGATAATTAAAATTTTGTTTTTAGTCCTTTGATAATA
AGAAGTAAAAATGTACCAAAATATAACATTAAACAATCTTATGATTTAAAAGATAAACAA
ACTGAGTTAAATAATTTAATTGAAGGATAAAATTAAACTGATCAAAATGACTAAATATTC
AATAAATAAGATAAATAAATTAATCACTTCAGCTAACAAAAATACAAATATGCTCAATTA
ATTAGTGATGACGATAGTTCGATTGAAGAGATTTTCAGGAATTATGAAAATAATATTGAC
TGA


>TTHERM_00675560(protein)
MYMKSLKNKIHTKYIAKKRRFQIQKFYQELFLIKKVCLITKQYQTIYLATQDFLIFDEIQ
QRKEQKVELNHLIQMHSEKKDFKLNSAATSDLFYNRQQFIQLVNEQIQLLETSVDSQNLN
EQYKFLSGFLRESSSLVIFLQQQMQTLYKLRIYQLSAVSVERNQLTPPKYDYLSNTECTF
QDLFSRNEQLKSQSSFQRAFDKSVQQSDSNFYIYPKQLAEENNSQNNNKYFDYMNNITPQ
QYQQKYQLYNNSSFFNDKNEDLFPVNLSESFKKIKNYSDFFDNQNNKQSTNFSEYFDTKN
RYRILKQQNLELDFIKVKQPTITDEAKENYVSQFGNQSQGKQIKIVKKNTCSNNNLAIFS
SPQQAMAQEEKIQSKNFSFEDMDVYEEKNTDKNYNQKFLRQEIPVQEFQLLNLPGSSPKQ
QNGGTPYKTFKEKQLYQKPINSNQTKQIQKFNQNNSYLDYDFDIQEGSVLKNCQKLNILN
NQVTNNQNEKKSFNMDNSKQINVLGTLQKNIQENGQIDSSQFKQNHYKNDISNTQERNTQ
NNLLGGAQNILQTNNQCNLLNNSNQKLNIQNSQISKISNNQQSNKQNQQSNLSSQQGQVS
YSQQSSHLNTQQSSNEKQNSNLFQGKISQKPQRKKKERAKKILKAYYQQNSDESLSSNPI
DKKKKISKTNNKLATSMRSKIQENDKIKTKLSKRDSNYGDSNLEESLFENDTSEESSNSD
LYYDQESENDDNDSLKQESDKSFDEDQSFSYSDEENLDDKGFIETQQANNSSKLNLTTKS
KRGHYKKYSVKLKKKLVNLLLEGEQPKDLSQKYNIPMKNLQRWKIYGAERREGGGRKIMD
LNMEVILLEYCIDYTLRGRCRCPRKLIMQKARDFTKEANKFKGSKGWLDKYSTRTGLSKI
MSEYKQLKISNEREIFKYVKCKSIEHIKQKIKQVNPLNIFTSQQYIKFLEGQLSVYQNFW
EIELPCYKNISSQYWQYYENRNTIQLIQNNIFSDVITEYKKFNKCSKLNDLNYYFGIPSE
YFLKCLCLQNCSEKSKQPNDQTIQHQNLKEQSQIVQEANSEYLKQDLIKQVKKEAVEERM
QSSAVLVDDNQNFVFSPLIIRSKNVPKYNIKQSYDLKDKQTELNNLIEGQNQTDQNDQIF
NKQDKQINHFSQQKYKYAQLISDDDSSIEEIFRNYENNID


>TTHERM_00675560(gene)
AAAATTGGCATTTAGGGAATTTTTTAGTAAAAGTAGAAAATGTATATGAAATCACTAAAA
AACAAAATCCATACTAAATACATAGCTAAAAAAAGGCGCTTTTAAATTTAAAAATTTTAT
CAGGAATTATTTCTTATCAAAAAGGTGTGTCTGATCACAAAATAATATCAAACTATTTAT
CTTGCTACTTAAGATTTTTTAATATTTGATGAAATTTAGTAAAGGAAAGAATAAAAAGTA
GAACTAAATCATTTAATATAGATGCACAGTGAAAAAAAAGATTTTAAACTTAATTCTGCT
GCCACTTCAGATTTATTTTACAATAGACAGTAATTTATTTAACTCGTTAATGAGCAAATT
TAACTTTTGGAGACATCTGTAGATAGTTAGAATCTTAATGAGCAGTATAAATTCTTATCT
GGTTTCTTAAGAGAGAGTATTATATTGAATGGATTTTATCATAATTTCATTATTTTTTAT
TAAAGGTAGTAGCTTAGTTATTTTTTTGCAGCAACAAATGTAAACTCTTTACAAGTTAAG
AATTTATCAATTATCTGCTGTTTCGGTTGAAAGAAATCAGCTAACTCCACCAAAATATGA
TTATTTGAGTAGTAAAAGAATTTATTTCATTTTATAAAAATAATAATAATATACAAAAAG
ATAAATCATAATATTTTAATTTGAAAATATAAATAGATACTGAATGTACATTTTAAGATT
TGTTTAGTAGAAACGAGCAGCTTAAAAGTCAATCTTCCTTTCAAAGGGCTTTTGATAAAT
CTGTTTAGTAAAGCGATTCTAATTTTTACATTTACCCGAAGCAACTAGCTGAAGAAAATA
ATAGTTAAAACAATAATAAGTATTTTGATTATATGAACAATATTACTCCTCAACAATATT
AATAAAAGTATTAACTTTACAACAACTCTTCTTTTTTTAATGATAAAAACGAAGATTTAT
TTCCTGTAAATCTTAGTGAGTCCTTTAAGAAAATTAAGAACTACTCAGATTTTTTCGATA
ACCAAAATAACAAGCAATCTACTAACTTTTCTGAATACTTTGATACTAAGAATAGATACA
GAATACTTAAGCAATAAAACCTTGAGCTAGATTTCATCAAAGTTAAACAACCAACCATCA
CAGATGAGGCTAAAGAAAATTATGTCAGCTAATTTGGCAATTAAAGTTAGGGCAAGCAAA
TAAAAATTGTAAAAAAGAATACCTGTAGTAACAATAATTTGGCTATATTTTCTTCTCCAC
AGCAAGCGATGGCTCAAGAAGAAAAGATACAGTCTAAGAACTTCTCGTTTGAAGACATGG
ATGTTTATGAAGAAAAAAATACAGATAAAAATTATAACTAAAAGTTTTTAAGACAAGAAA
TTCCCGTTTAAGAGTTTTAACTTTTAAATTTGCCTGGTTCTTCTCCCAAGCAGCAGAATG
GTGGCACTCCTTATAAAACATTTAAAGAAAAGTAGCTCTATTAAAAACCAATAAATTCTA
ATTAAACCAAACAAATATAGAAATTCAATTAAAATAATAGCTATCTAGACTATGATTTTG
ACATACAAGAAGGAAGTGTTTTAAAAAATTGTTAAAAATTGAATATTTTAAATAATTAGG
TTACAAATAATTAAAATGAGAAGAAGTCTTTTAACATGGATAATTCTAAATAAATTAATG
TATTAGGTACTTTGCAAAAAAATATTTAAGAAAATGGCTAAATTGATTCATCTCAATTTA
AGTAAAATCACTACAAAAATGATATTTCAAATACATAAGAAAGGAATACTTAAAACAATT
TGCTTGGAGGAGCTTAAAACATTTTACAGACAAATAATTAATGCAATTTATTGAATAATT
CTAATTAAAAATTAAATATTTAAAATAGTTAAATATCAAAGATTTCTAATAATCAATAAA
GTAATAAATAAAACTAATAAAGTAATTTAAGTAGTTAATAAGGTCAAGTTTCTTACAGTT
AATAAAGTTCTCACTTAAATACTTAATAAAGCTCAAATGAAAAATAAAATTCTAATTTAT
TTTAAGGAAAAATAAGCTAAAAACCACAACGAAAGAAAAAAGAAAGAGCAAAAAAAATCT
TGAAAGCATACTATCAGCAGAACAGCGATGAATCCTTAAGCAGCAATCCAATTGATAAGA
AGAAAAAAATATCTAAAAGTAAAATATCAAATTAATTTTTTTTTAGTTGATTTAAGTTAA
TTTTTATTTATTTTAAATATTCAGCCAATAACAAGCTTGCTACCTCAATGAGAAGTAAAA
TATAAGAAAATGATAAAATAAAGACAAAATTAAGTAAAAGAGATTCAAATTATGGTGATA
GTAATTTAGAAGAATCTCTATTTGAAAATGATACTAGCGAAGAAAGCAGCAATTCTGACT
TATATTATGATTAAGAAAGTGAAAATGATGATAATGATAGCTTAAAGCAAGAGTCAGATA
AAAGTTTCGATGAAGATTAGTCTTTTTCATACTCAGATGAAGAGAATTTAGACGACAAAG
GTTTTATAGAAACATAGCAAGCAAATAACTCTAGTAAACTGAATTTGACAACAAAATCAA
AAAGAGGGCATTACAAAAAATATTCTGTGAAACTAAAGAAAAAATTGGTTAATCTAGTAA
AAAATTAAACTAAATTATTAATACTTAAAAACTTATTATTTATAAATTATAAAGCTTCTG
GAAGGAGAATAGCCAAAGGATCTCTCTTAAAAATATAATATTCCTATGAAAAATTTATAA
AGATGGAAAATTTATGGTGCTGAAAGAAGGGAAGGAGGAGGAAGAAAGATCATGGATTTA
AATATGGAAGTTATTCTTTTAGAGTATTGTATTGATTATACATTAAGAGGAAGGTGTAGA
TGTCCTAGAAAATTAATTATGCAAAAAGTAATCAATTCTATTTATTTTATTATTTTTTTA
AGTTTTCTGATATTAAAAGATATTTATTTACATCTTAAAATTATATTAATTTTAATAAAT
TTGTTTAAATTACTCTAATCTATTTGTTTTTTTTTCATTAACGAACGAGAAAATGGTAAA
AATTAAATATAAACACAAAAAAAATAACCTAAAAATAATTACAACATATTTTAATATTTC
CAAAAATAAAAAATTATTTATTATTGATTAAAATTTTAATAAACTAATGCTTAATTTTAG
AATATTTAGTTTTAGGATTTTATTTTATATTGTCTAAGCAATTACAGTTGATATAAATTA
ATTGCTATTTTAATATTTTAAAATATTTAAATTAAAAGGCAAGAGATTTTACTAAAGAGG
CTAATAAGTTTAAAGGATCAAAAGGTTGGCTTGATAAATACTCTACTAGAACTGGTCTGT
CAAAGATAATGTCAGAGTATAAACAATTAAAGATTAGTAATGAGAGAGAAATCTTCAAAT
ATGTTAAATGTAAATCAATTGAGCATATTAAATAAAAGATAAAATAGGTAAATCCTCTAA
ACATATTTACAAGTTAGCAATACATTAAATTTTTAGAAGGGCAACTTTCTGTTTATTAGA
ATTTTTGGGAAATTGAATTACCTTGCTATAAAAACATTTCTAGTTAATATTGGCAGTATT
ATGAAAATAGAAACACAATTTAACTAATTTAAAATAACATCTTTAGTGATGTTATAACTG
AATATAAAAAATTTAATAAGTGTTCTAAATTAAATGACCTTAACTATTACTTTGGTATTC
CATCTGAATATTTCTTAAAATGTCTTTGCCTTTAAAATTGCTCTGAGAAAAGCAAGCAAC
CAAACGATTAAACAATACAACATTAAAATTTGAAAGAACGTAAACACATTCAATATATCT
ACAAAATCACTTTAAAAAAATTTTTTTATTTATTTATAAAGAGTCTTAGATAGTTTAAGA
AGCAAATTCAGAATATTTAAAGCAGGATCTCATAAAATAAGTAAAAAAAGAAGCAGTTGA
AGAGAGAATGCAAAGCTCAGCAGTTTTGGTAGATGATAATTAAAATTTTGTTTTTAGTCC
TTTGATAATAAGAAGTAAAAATGTACCAAAATATAACATTAAACAATCTTATGATTTAAA
AGATAAACAAACTGAGTTAAATAATTTAATTGAAGGATAAAATTAAACTGATCAAAATGA
CTAAATATTCAATAAATAAGATAAATAAATTAATCACTTCAGCTAACAAAAATACAAATA
TGCTCAATTAATTAGTGATGACGATAGTTCGATTGAAGAGATTTTCAGGAATTATGAAAA
TAATATTGACTGA