Identifiers and Description

Gene Model Identifier

TTHERM_00046760

Standard Name

HAT1 (Histone AcetylTransferase 1)

Aliases

PreTt11155 | 3.m01941 | 3824.m02916 | KAT1

Description

Histone acetyltransferase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00046760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01775.19.997093137033517e-262hypothetical protein (472 aa)
OxytrichaContig10852.0.g203.00033207980219e-32Histone acetyl transferase HAT
1 N-terminus
DictyBaseDDB_G02751599.995528898049344e-31DDB_G0275159 on chromosome: 2
position 5204831 to 5206231
WormBaseWBGene000440692.9993110246221282e-28locus:hat-1 status:Confirmed
UniProt:Q21484 protein_id
:CAA88954.2
SGDYPL001W6.001122775063233e-17HAT1 Catalytic subunit of the
Hat1p-Hat2p histone acetyltran
sferase complex that uses the
cofactor acetyl coenzyme A, to
acetylate free nuclear and cy
toplasmic histone H4; involved
in telomeric silencing and DN
A double-strand break repair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046760(coding)
ATGTCTGATAAGAAAAACCAAAAAATTGACCTCTCTTAGTTTGAGGGTCCAGATGGAATG
CAAAAGCTAATGAAATTAGCTATGGAGTTCCAAGAAAATGAAAAATAACAAAAAGGATAA
AAAAAGAATAAAAAAAAAGTAGATTAAGACTTAGGAGAAGACGGAGATGCTAATTCATAA
GCAGAAAATGACGATGATGGTGATGATGATGAAGAGGAAGAAATTAAGGCAAGGGAAGGC
TGTAGTTTAGCATATGATGCTTTGAATATTAAATTTGTATAAGAAGAGAATGATTTGAAC
CCTTTATTTAAAAAGAATATGCTCTTTAAGCCAAATTATGTTCATCAAATTTATGGTTAA
GAAGAAGAAATAGAAGGTTATGAAGACCTACAAATTAATATTTATATGCTTTCAGGCTCT
CTCCATACATTAGTTGAATACTCTTATGGAAAAAAGATGAAATAGCATGAAGATTTTTTA
TAGAAGCTTCGTGATAATTGTTTTGTGAGTGATTTTTGTCTCAAGCGCAAAGAATTCAAT
TAGCATATGGCCAAAGAGAAGTCATTTAAACCAATTGGAGATAAATTCAAAGAAATAACT
GCAAAAAATGGAGAAAAATTTGAAATATATTATTGTAATACTTAAAAACACCCAGAATTC
TCTGAATATAAAAAGCGCATGCAAGTATTTGCTAAATTCTTTATCGAAGTAGGCTCCTAC
ATTGAAGATAATGAATATTGGCATCACTTCCTTATTTTCCATGTTGATTAGAATGGAATG
TACACTTTTGCAGGATTTACAAATAAATATGAATACATGTTTAACATCAATAAATCAAGA
CATTAAATTTCTTAGATTGTAATTCTTCCTATCTTCTAAAGATTAGGCCTTGCTACAGAG
CTTTTGAATTGTCACTATAAAACTGCCTAAGAAGATAGTAAGTGTTTAGAATTAACAGTA
GAGGATCCCTCACCTGAATTCCAAATCGTTAGAGATATTATTGAAACTAAATTAGTCATT
GATGGAAAGTTTTGGCAATGGTTTGAAGCTATTCGCCCAAAAACAATAAGAGGCATTCTT
TAGCTTGAAGGAATATAAATTAGTCACTAATAAGAAATTACCCAAGCTACTAAAATTCCT
AAATATTAAATATAAAGAATTTTTGAAATTCTTATGCTTAGCAAATTAGATTAATCAAAT
AAGTAGGTTATGGACAGATATAGAGGACATTTTATCAAATATAGAAAAGATGTTAATGAA
GTCAGAACTCAAAGAAAAGTTCCTTATATAATTTTTGATAATAAGGCTGTTAAAATTGAT
GTATAAGCTATCATTGAATAAAAAAAACAATTGGAGCCTAATGATGCCTTTTATTTAGAA
GAATATGAACAAACACTAGAACAATATAATAATGTAATTTAAAAACTCAAGATTTGA


>TTHERM_00046760(protein)
MSDKKNQKIDLSQFEGPDGMQKLMKLAMEFQENEKQQKGQKKNKKKVDQDLGEDGDANSQ
AENDDDGDDDEEEEIKAREGCSLAYDALNIKFVQEENDLNPLFKKNMLFKPNYVHQIYGQ
EEEIEGYEDLQINIYMLSGSLHTLVEYSYGKKMKQHEDFLQKLRDNCFVSDFCLKRKEFN
QHMAKEKSFKPIGDKFKEITAKNGEKFEIYYCNTQKHPEFSEYKKRMQVFAKFFIEVGSY
IEDNEYWHHFLIFHVDQNGMYTFAGFTNKYEYMFNINKSRHQISQIVILPIFQRLGLATE
LLNCHYKTAQEDSKCLELTVEDPSPEFQIVRDIIETKLVIDGKFWQWFEAIRPKTIRGIL
QLEGIQISHQQEITQATKIPKYQIQRIFEILMLSKLDQSNKQVMDRYRGHFIKYRKDVNE
VRTQRKVPYIIFDNKAVKIDVQAIIEQKKQLEPNDAFYLEEYEQTLEQYNNVIQKLKI


>TTHERM_00046760(gene)
ATGTCTGATAAGAAAAACCAAAAAATTGACCTCTCTTAGTTTGAGGGTCCAGATGGAATG
CAAAAGCTAATGAAATTAGCTATGGAGTTCCAAGAAAATGAAAAATAACAAAAAGGATAA
AAAAAGAATAAAAAAAAAGTAGATTAAGACTTAGGAGAAGACGGAGATGCTAATTCATAA
GCAGAAAATGACGATGATGGTGATGATGATGAAGAGGAAGAAATTAAGGCAAGGGAAGGC
TGTAGTTTAGCATATGATGCTTTGAATATTAAATTTGTATAAGAAGAGAATGATTTGAAC
CCTTTATTTAAAAAGAATATGCTCTTTAAGCCAAATTATGTTCATCAAATTTATGGTTAA
GAAGAAGAAATAGAAGGTTATGAAGACCTACAAATTAATATTTATATGCTTTCAGGCTCT
CTCCATACATTAGTTGAATACTCTTATGGAAAAAAGATGAAATAGCATGAAGATTTTTTA
TAGAAGCTTCGTGATAATTGTTTTGTGAGTGATTTTTGTCTCAAGCGCAAAGAATTCAAT
TAGCATATGGCCAAAGAGAAGTCATTTAAACCAATTGGAGATAAATTCAAAGAAATAACT
GCAAAAAATGGAGAAAAATTTGAAATATATTATTGTAATACTTAAAAACACCCAGAATTC
TCTGAATATAAAAAGCGCATGCAAGTATTTGCTAAATTCTTTATCGAAGTAGGCTCCTAC
ATTGAAGATAATGAATATTGGCATCACTTCCTTATTTTCCATGTTGATTAGAATGGAATG
TACACTTTTGCAGGATTTACAAATAAATATGAATACATGTTTAACATCAATAAATCAAGA
CATTAAATTTCTTAGATTGTAATTCTTCCTATCTTCTAAAGATTAGGCCTTGCTACAGAG
CTTTTGAATTGTCACTATAAAACTGCCTAAGAAGATAGTAAGTGTTTAGAATTAACAGTA
GAGGATCCCTCACCTGAATTCCAAATCGTTAGAGATATTATTGAAACTAAATTAGTCATT
GATGGAAAGTTTTGGCAATGGTTTGAAGCTATTCGCCCAAAAACAATAAGAGGCATTCTT
TAGCTTGAAGGAATATAAATTAGTCACTAATAAGAAATTACCCAAGCTACTAAAATTCCT
AAATATTAAATATAAAGAATTTTTGAAATTCTTATGCTTAGCAAATTAGATTAATCAAAT
AAGTAGGTTATGGACAGATATAGAGGACATTTTATCAAATATAGAAAAGATGTTAATGAA
GTCAGAACTCAAAGAAAAGTTCCTTATATAATTTTTGATAATAAGGCTGTTAAAATTGAT
GTATAAGCTATCATTGAATAAAAAAAACAATTGGAGCCTAATGATGCCTTTTATTTAGAA
GAATATGAACAAACACTAGAACAATATAATAATGTAATTTAAAAACTCAAGATTTGA