Identifiers and Description

Gene Model Identifier

TTHERM_00112490

Standard Name

HARPL1 (HepA-Related Protein-Like 1)

Aliases

PreTt27063 | 8.m00323 | 3812.m02360

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00112490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03966.19.997093137033517e-262hypothetical protein (1005 aa)
OxytrichaContig18000.0.g593.000619078166531e-39SNF2 family N-terminal domain
DictyBaseDDB_G02815596.001696815660978e-24DDB_G0281559 on chromosome: 3
position 4978870 to 4981935
Stentor CoeruleusSteCoe_158730.0000000001026187963170189
WormBaseWBGene000158060.0000000010002658722841845Putative SMARCAL1-like protein
status:Partially_confirmed
UniProt:Q8MNV7 protein_id:
CCD63221.1
SGDYBR245C0.000006997203421143941ISW1 Member of the imitation-s
witch (ISWI) class of ATP-depe
ndent chromatin remodeling com
plexes; ATPase that forms a co
mplex with Ioc2p and Ioc4p to
regulate transcription elongat
ion, and a complex with Ioc3p
to repress transcription initi
ation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00112490(coding)
ATGATTACATCTATTTAACAGATTAGTAACACATAAGCTCTGGTACAAGTCGAAAACCAA
ATACTAATTAAAGATCCTTATATAAAGAGATATTTGCAAAATTAAAATAGAAGCAAATAT
GAGGAGAAATACAATGGATATCTAATAGATATCGCAGAGTCTTCATTCATGAAAGATAAG
ATTAATTTTTAGATTAGCGCCAAATAAAAGAAAAAGAAATTATCAGATATCCCAAGATTT
GTGACAGAAGCTTTTACAGACTTTGGGAATAAGTTAAAAATTAGAGACTTAAAAGGCAAC
ATTGTTTCAGAGATCAATTATGGAAATGAATAACTTGCAAATGATCTTGGATTATCTTAG
GAACATATCAGTGATGCTATTTAAATGGCTTTTCAGATGAGAGGAAGAGTTATCCTTGCT
GATGACCCAGGACTGAATTCATGCAAAACAGCAGTCAATATTGCATATGCTTATGATTAT
AAAATACCTTTTTTAATAATTGCTTCTTCTACTCAGCGTTAGAAATGGAAATCAATACTA
AAATAACAATTTAGCCTGAAAGATAAAGACATATAAATTTTATATAACAATTAAACTTAA
TTTGATTTCAAAAAGGATGCAATAATAGCTACATATGATCAAGTTTCTACTAGAAAAGAG
GAACTTCAAGATATAAAAGTTGCTTTAGTAGATGAGGCTCATTACTTGAGAAATATAAAG
TTTGTAAATGAGAGAAATTTAATGGAGTATTTATGCAAAAGAAAAAGAGTTGTCCTTTTG
AGTAGTTGCTGTATTATATAATCAGTTGAAGATCTATTTCCTTTGCTAAGAGTTATTCGT
CCTGACTGCTTCCATAATACTAAAGCTTTCAAAGACAGATATGTTAACAATGAAAATAAT
TGGATAGAACTTCATTGTATGCTAAATTAAATAGGATTTATTAGAAGAACAAGATAAATG
TTCGCAGATAACCATAATTTTACTAATTTTGGAATTGTTCCTATAGAATGTGATAAAAGT
GTTACATCAATTATAAATAGCCTCGTTCATAATGCACATAGAATTGGAGGAAACTTTTCA
AAAGGTATCTATTCATAATGCTATACTTTATCATTAGATGCAAAGATCAAGGGTTGCTTG
TAATTCATAGATAGATAATTAGAATAAAAACCTGATGATAAAATAGTAATTTTTGGATAT
CATCAGAAATCTTTCGAGATGATTGGTACCCATTTATAAGCAAAAAATATTACTTTCATA
GTTGTTGATAAAAAAACTAATTTTGCTTAAAAAGAAGAGTTACTACATCAAATAGATCCA
TAAATTAGCGTTGTTTTGATGTCTTTCACAAATTTATAAGATATTGAGTTATCCCTATTT
TCTACAGCTATTGTCTTGGAATTTTCTTGGACTCCACATTTAATAGATCAAGCTATTGGT
TGTTTATATAGCTTAAGTCAAGTGAATGAATAAGTAGATGCTTTTTTACTTGAAGGTATA
GGGACACTTGACAAATTACTAAAAGGGAAATACATCAAGTGGTTAGATTTGAAAACTAAA
ATTTTAGATGGGAAAAAAGTAGATAATTTACTAAATATTCAAGATGTAGTGAGTATTGAT
AATTAAGGTTCAAATAGATTAAGATAGAATTAAAGCATAGATATAAGCTTCAATGAAGAT
AATCATTTGTCAAACTAACCTTCAAAAGCATACAATTAGCAGAAATCTCCTCAATAGAAA
AAAAAGAGAAGTAGAAAAAATATTTAAAAATTTGAAATATCTAAGCTAAATACTAGTAAA
TAAAGAATAACAACTTAGACATTAAGCTAGGATATACTACCACCTGAAATAAAGGTAGAT
ATTAATTAGAGCAAAAAAATCTTTATGTAGAAAGCCAGAACTGTTGAAGATTTAAAAAAG
AATAATAATAACACCAAGTATAAAAATGAAAAATTTTTTTAATAATAATAACATGATATG
GAGATAATTATATCTGAGGATGATATTGAAAATATAACAGATGAAAGATAAATCACAAAT
ATGGGTTAAAAGAATAATAATTATAATAATAAAAATAATTATTACGAATTGAATCGCTAG
TAAAACGAATAAAAAGATGAATAGGTATTTATGACAGACTATACTTAAAGCTTTAATGAA
GGATTTATTTCTATTTATGAAGATATTGAGAATAATTAAAGTAAAAATGTATACCGTGAT
GAAGAACAATTCGACTTTGACTATGAAGAGAATGAATTCAATTAAATAAAAAGAAAAAAG
AACTATTCAAATAGAAGTATGCCTAGTAATTACTTAAAAGATATAGAGTGCGATTTAAAT
ATCTCTGAAATATAAAACAATTAAGTCAATTCAATAGATTTTGGCTATGATGAGACACCT
ATAAACAAATTTCAGAGCTAAAAGAGCGAATCTCATGCTTCTTTATATAAATAGATTATT
TCTAAAATAACTGATTACACAGAACCAATAACACTTCAAGTGGAAGATTACACAAATGAC
TAAAAGAGTTAATGTTAAAAACCTTCAAAAATTATTTAAGAGAAAAAATAAATGATTTAA
TAAACACCTAATTTTATAGCCCAAAAATAAACTGACAACGATTTGGATTTTTTGTTGAAA
GAATTAGAAATAGAAATAGATTTTGAAGAAAAGGACAAATCAAACTCACAAAAATTGGAC
TGCGACAGTATACCATTTTAAATATTGGACGAAGACAGCAATCTAGAAAAAAACTCTTAA
AAAGATAACTTAAATCATTCTAATTTATCTAACTAGCCAATTGTTTATAAGGGAAAATAA
ATATCAGCAGAAAAAATTACATAGAAAAAAATACCTCTTAAAGACTAACCATTCTGTAGG
AAATTATTTGATGATGAATTTAGCTCTCCATTTGGAGCTTTTAGCAAAGAATCTGCTTTA
ACAAAATGCTCTACTAACCATTTTGTGAATGATAATAGCTGTAAGAAATCTAGTGTTTTC
GATAAGCTAATATTAGATATTGATGAAAGCACTAAAAAATCTAATGTTTTTAACGATTAA
TTGAACCCTAAATAAAATGTAGACTAAGGTGATCTAGAATATGATGATTTATTTTCAATA
AACGGATAAAATGCTATAGGATTTTTTGAAATAAATAAAAAATTGAATCATAATACAAAT
AATAACAAGAATTTAAGCAAAGAACAATTTAAAACTCAACAATTATTTAAAGATACTCAA
AAAACAAATGACAAAAATCTATTTAATTAGTCCGATAAAAATATAGAAGCCCCTTAATAA
ATGAAATTTACTGGATTAAAGAAAAGGAAACTTAACAATTCTTTCAAGTTAGATCCAAAG
CAATTACTAAAAAAGAAAAAAATAAAAACAAATTGA


>TTHERM_00112490(protein)
MITSIQQISNTQALVQVENQILIKDPYIKRYLQNQNRSKYEEKYNGYLIDIAESSFMKDK
INFQISAKQKKKKLSDIPRFVTEAFTDFGNKLKIRDLKGNIVSEINYGNEQLANDLGLSQ
EHISDAIQMAFQMRGRVILADDPGLNSCKTAVNIAYAYDYKIPFLIIASSTQRQKWKSIL
KQQFSLKDKDIQILYNNQTQFDFKKDAIIATYDQVSTRKEELQDIKVALVDEAHYLRNIK
FVNERNLMEYLCKRKRVVLLSSCCIIQSVEDLFPLLRVIRPDCFHNTKAFKDRYVNNENN
WIELHCMLNQIGFIRRTRQMFADNHNFTNFGIVPIECDKSVTSIINSLVHNAHRIGGNFS
KGIYSQCYTLSLDAKIKGCLQFIDRQLEQKPDDKIVIFGYHQKSFEMIGTHLQAKNITFI
VVDKKTNFAQKEELLHQIDPQISVVLMSFTNLQDIELSLFSTAIVLEFSWTPHLIDQAIG
CLYSLSQVNEQVDAFLLEGIGTLDKLLKGKYIKWLDLKTKILDGKKVDNLLNIQDVVSID
NQGSNRLRQNQSIDISFNEDNHLSNQPSKAYNQQKSPQQKKKRSRKNIQKFEISKLNTSK
QRITTQTLSQDILPPEIKVDINQSKKIFMQKARTVEDLKKNNNNTKYKNEKFFQQQQHDM
EIIISEDDIENITDERQITNMGQKNNNYNNKNNYYELNRQQNEQKDEQVFMTDYTQSFNE
GFISIYEDIENNQSKNVYRDEEQFDFDYEENEFNQIKRKKNYSNRSMPSNYLKDIECDLN
ISEIQNNQVNSIDFGYDETPINKFQSQKSESHASLYKQIISKITDYTEPITLQVEDYTND
QKSQCQKPSKIIQEKKQMIQQTPNFIAQKQTDNDLDFLLKELEIEIDFEEKDKSNSQKLD
CDSIPFQILDEDSNLEKNSQKDNLNHSNLSNQPIVYKGKQISAEKITQKKIPLKDQPFCR
KLFDDEFSSPFGAFSKESALTKCSTNHFVNDNSCKKSSVFDKLILDIDESTKKSNVFNDQ
LNPKQNVDQGDLEYDDLFSINGQNAIGFFEINKKLNHNTNNNKNLSKEQFKTQQLFKDTQ
KTNDKNLFNQSDKNIEAPQQMKFTGLKKRKLNNSFKLDPKQLLKKKKIKTN


>TTHERM_00112490(gene)
ATGATTACATCTATTTAACAGATTAGTAACACATAAGCTCTGGTACAAGTCGAAAACCAA
ATACTAATTAAAGATCCTTATATAAAGAGATATTTGCAAGTAACTTTACTCATTTTAACA
TAAAAAAAAGTAAGTTAAATTTATTTTTAAGAATTAAAATAGAAGCAAATATGAGGAGAA
ATACAATGGATATCTAATAGATATCGCAGAGTCTTCATTCATGAAAGATAAGGTACTTAA
TTTTGGATTTCAAATCGAAGCTAAACGGATTTTTTAAATTTCGAAAGATTAATTTTTAGA
TTAGCGCCAAATAAAAGAAAAAGAAATTATCAGATATCCCAAGATTTGTGACAGAAGCTT
TTACAGACTTTGGGAATAAGTTAAAAATTAGAGACTTAAAAGGCAACATTGTTTCAGAGA
TCAATTATGGAAATGAATAAGTATAATGTTATATTTGATTTTTCTATTTCAAGATTATTA
ATTAAATTTTAATTTAAAAAATATTTTAAAATAAATTAAAATTAATAGCTTGCAAATGAT
CTTGGATTATCTTAGGAACATATCAGTGATGCTATTTAAATGGCTTTTCAGATGAGAGGA
AGAGTTATCCTTGCTGATGACCCAGGACTGAATTCATGCAAAACAGCAGTCAATATTGCA
TATGCTTATGATTATAAAATACCTTTTTTAATAATTGCTTCTTCTACTCAGGTTTTATTG
TTATTTTATGCTTATTTTATTAATTTTTAAAAATATTTAACTTAGCGTTAGAAATGGAAA
TCAATACTAAAATAACAATTTAGCCTGAAAGATAAAGACATATAAATTTTATATAACAAT
TAAACTTAATTTGATTTCAAAAAGGATGCAATAATAGCTACGTAAGTTTTTATTAACATT
TTAATTAAAATATGTTTAATTAGTTGATATTTAAATAAAAGATATGATCAAGTTTCTACT
AGAAAAGAGGAACTTCAAGATATAAAAGTTGCTTTAGTAGATGAGGCTCATTACTTGAGA
AATATAAAGTTTGTAAATGAGAGAAATTTAATGGAGTATTTATGCAAAAGAAAAAGAGTT
GTCCTTTTGAGTAGTTGCTGTATTATATAATCAGTTGAAGATCTATTTCCTTTGCTAAGA
GTTATTCGTCCTGACTGCTTCCATAATACTAAAGCTTTCAAAGACAGATATGTTAACAAT
GAAAATAATTGGATAGAACTTCATTGTATGCTAAATTAAATAGGATTTATTAGAAGAACA
AGATAAATGTTCGCAGATAACCATAATTTTACTAATTTTGGAATTGTTCCTATAGAATGT
GATAAAAGTGTTACATCAATTATAAATAGCCTCGTTCATAATGCACATAGAATTGGAGGG
TAATTAATGCAAATTTATTTTTTTTAACTAAAATTGCTTAAATTTAAGTTAAATATTTGG
TTTATACTTGAGATAAAAGAGAAAATTATTAAGTAATACACCTTATTCTTTCAAACATCA
TAACTTTTAATTCAAAAAATGAAAGAGTTTCCTAGTTAATTGAAAAAATCCATATTTTTG
GCTTACCTCGTAAATCAAAATACTAAGTTTATCGATACAATACGATATATTAGTTACATC
TGATAACTATCCACTAAAACATACTATAAAATCAAAATGATAGAAATTTTATTTTTATAT
AATGAGATAAAATTTAATAATAATCAGTATAAAAATTAGGATATATTGATTAATAAAATA
AATTTTATATTTAAAAAAATTTAATAATTATTTTATTAAAATTTAATAGAAACTTTTCAA
AAGGTATCTATTCATAATGCTATACTTTATCATTAGATGCAAAGATCAAGGGTTGCTTGT
AATTCATAGATAGATAATTAGAATAAAAACCTGATGATAAAATAGTAATTTTTGGATATC
ATCAGAAATCTTTCGAGATGATTGGTACCCATTTATAAGCAAAAAATATTACTTTCATAG
TTGTTGATAAAAAAACTAATTTTGCTTAAAAAGAAGAGTTACTACATCAAATAGATCCAT
AAATTAGCGTTGTTTTGATGTCTTTCACAAATTTATAAGATATTGAGTTATCCCTATTTT
CTACAGCTATTGTCTTGGAAGTAAGTTTAATAAATATTTGTTATTTTATTTAGTATTAAA
AATTTGATTAGTTTTCTTGGACTCCACATTTAATAGATCAAGCTATTGGTTGTTTATATA
GCTTAAGTCAAGTGAATGAATAAGTAGATGCTTTTTTACTTGAAGGTATAGGGACACTTG
ACAAATTACTAAAAGGGAAATACATCAAGTGGTTAGATTTGAAAACTAAAATTTTAGATG
GGAAAAAAGTAGATAATTTACTAAATATTCAAGATGTAGTGAGTATTGATAATTAAGGTT
CAAATAGATTAAGATAGAATTAAAGCATAGATATAAGCTTCAATGAAGATAATCATTTGT
CAAACTAACCTTCAAAAGCATACAATTAGCAGAAATCTCCTCAATAGAAAAAAAAGAGAA
GTAGAAAAAATATTTAAAAATTTGAAATATCTAAGCTAAATACTAGTAAATAAAGAATAA
CAACTTAGACATTAAGCTAGGATATACTACCACCTGAAATAAAGGTAGATATTAATTAGA
GCAAAAAAATCTTTATGTAGAAAGCCAGAACTGTTGAAGATTTAAAAAAGAATAATAATA
ACACCAAGTATAAAAATGAAAAATTTTTTTAATAATAATAACATGATATGGAGATAATTA
TATCTGAGGATGATATTGAAAATATAACAGATGAAAGATAAATCACAAATATGGGTTAAA
AGAATAATAATTATAATAATAAAAATAATTATTACGAATTGAATCGCTAGTAAAACGAAT
AAAAAGATGAATAGGTATTTATGACAGACTATACTTAAAGCTTTAATGAAGGATTTATTT
CTATTTATGAAGATATTGAGAATAATTAAAGTAAAAATGTATACCGTGATGAAGAACAAT
TCGACTTTGACTATGAAGAGAATGAATTCAATTAAATAAAAAGAAAAAAGAACTATTCAA
ATAGAAGTATGCCTAGTAATTACTTAAAAGATATAGAGTGCGATTTAAATATCTCTGAAA
TATAAAACAATTAAGTCAATTCAATAGATTTTGGCTATGATGAGACACCTATAAACAAAT
TTCAGAGCTAAAAGAGCGAATCTCATGCTTCTTTATATAAATAGATTATTTCTAAAATAA
CTGATTACACAGAACCAATAACACTTCAAGTGGAAGATTACACAAATGACTAAAAGAGTT
AATGTTAAAAACCTTCAAAAATTATTTAAGAGAAAAAATAAATGATTTAATAAACACCTA
ATTTTATAGCCCAAAAATAAACTGACAACGATTTGGATTTTTTGTTGAAAGAATTAGAAA
TAGAAATAGATTTTGAAGAAAAGGACAAATCAAACTCACAAAAATTGGACTGTAATTAGC
TATAACCGTTTTAACAATATTTATTTTCTTTTTCACATTATTTATAAAATAGGCGACAGT
ATACCATTTTAAATATTGGACGAAGACAGCAATCTAGAAAAAAACTCTTAAAAAGATAAC
TTAAATCATTCTAATTTATCTAACTAGCCAATTGTTTATAAGGGAAAATAAATATCAGCA
GAAAAAATTACATAGAAAAAAATACCTCTTAAAGACTAACCATTCTGTAGGAAATTATTT
GATGATGAATTTAGCTCTCCATTTGGAGCTTTTAGCAAAGAATCTGCTTTAACAAAATGC
TCTACTAACCATTTTGTGAATGATAATAGCTGTAAGAAATCTAGTGTTTTCGATAAGCTA
ATATTAGATATTGATGAAAGCACTAAAAAATCTAATGTTTTTAACGATTAATTGAACCCT
AAATAAAATGTAGACTAAGGTGATCTAGAATATGATGATTTATTTTCAATAAACGGATAA
AATGCTATAGGATTTTTTGAAATAAATAAAAAATTGAATCATAATACAAATAATAACAAG
AATTTAAGCAAAGAACAATTTAAAACTCAACAATTATTTAAAGATACTCAAAAAACAAAT
GACAAAAATCTATTTAATTAGTCCGATAAAAATATAGAAGCCCCTTAATAAATGAAATTT
ACTGGATTAAAGAAAAGGAAACTTAACAATTCTTTCAAGTTAGATCCAAAGCAATTACTA
AAAAAGAAAAAAATAAAAACAAATTGA