Identifiers and Description

Gene Model Identifier

TTHERM_01080500

Standard Name

HARP2 (HepA-Related Protein 2)

Aliases

PreTt02092 | 222.m00048 | 3798.m00205

Description

helicase carboxy-terminal domain protein; Helicase conserved C-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01080500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20245.19.997093137033517e-262helicase domain-containing pro
tein (1135 aa)
OxytrichaContig18000.0.g591.0000832086161474e-142SNF2 family N-terminal domain
DictyBaseDDB_G02749659.997540506729281e-98DDB_G0274965 on chromosome: 2
position 4676573 to 4680775
WormBaseWBGene000158066.998237764718294e-90Putative SMARCAL1-like protein
status:Partially_confirmed
UniProt:Q8MNV7 protein_id:
CCD63221.1
Stentor CoeruleusSteCoe_158735.166420632837861e-55
SGDYPL082C9.99648502569394e-38MOT1 Essential abundant protei
n involved in regulation of tr
anscription, removes Spt15p (T
BP) from DNA via its C-termina
l ATPase activity, forms a com
plex with TBP that binds TATA
DNA with high affinity but wit
h altered specificity

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_01080500(coding)
ATGTATTTTTAATAATTCTAGAAAGGTGGCTATGGGAATTTCAATCGATAAAATAGTAGC
AATTATAACTATAATAATAACAATAATAATGTTGATAAAAAACAAATAACTATTCAGCTT
GTTTAAGATAATACAATACTTATCTCTGGTTCGTATACAAGCTTTACAGAATAGAGAAAA
GATATCATAAAAAAATTAGGAGGTTCTTGGGATAATGACAGAAAGGGATGGAGATGTTAA
TATTCATAATATAATCTTATAAAATAAAATATAGAAAAGACAGGTGTTGAAATTTAAGGA
ATACCAGATTTTGTAAATAGTGCAATAAAGTCAATAAATGAAAAATTGACATTCCAAACA
GATAAAAAATAATATGAAATACTATATAATCCAGAAGACATAAATAAAAAAATAGAAAAT
GAGCTACCACAAAAAACAGTTACCAATCTGTATAATTTTCAAAAGCAAGGTGTGTAATTT
GGGTTAAAAAATAACGGTAGAGTTCTCATAGCTGATGAAATGGGTGTTGGTAAAACAATT
CAGGCTATCTGTTTAGCAAGCTGTTATAAATCTGCATGGCCGCTACTTATTATATGTCCA
TCTTCTTTAAAATATAATTGGAAAGAAGAAATTGTAAAATGGGCGTATCCTCCTCTTAAA
GAAATGCAGGTTCAGATATTGTCAAAATAAGCAGAAGAAATATATATAATGACTAGGGTT
TTAATTGTCTCATATGATCTGGCTCCAAAAGTTGAAGAAAAAATAAAAAGATTTAAAACT
AATATTGTAATTGCAGATGAAGCTCATTACTTAAAGAACGCTTAAGCTAAAAGGACGAAT
AGTTTATTACCAATTCTTTAAAAAATAAAACATGTTATTCTTTTGACTGGTACTCCTGCA
TTTGCTAGACCAAAAGAAATGTTTACTCTTCTTTCTATTATTCGCCCTGATATATTTAAG
ACTTTCAAAAGTTTTGGAGATAGATATTGTGATCCCAAACCAGCTAGATTTGGAGGAGGA
ATAGATTACACTGGTTCCACTAATGAAAAAGAATTATTCTATATTTTAAAGAAAACGATT
ATGATTAGGAGATTGAAATAAGATGTGCTCTCGTAATTGCCTTCAAAGAGAAGAAAAAAA
GTTCATGTTAACGTTGACCCAAAAATTTTATCAGAAATATAAGCAATTCTTAATCAAACA
AACAAAAGCTCTTTAGAATAACTGTTTGAGTAAGCTCAAAAATAAAATGAGTCAAGCAAT
GAAGAATAAAATGGCTCTTCATCAATGTTTTCTGCTCTTTCACTTTGCTACTAATTAAGT
GGATAAGCCAAGTTACATGAATTAAAAAACTATATTAAAGATTTATTGGAAAATGATATA
AAAATTATTGTATTTGCTCATCATAATGAAATGTTAAACTAGCTTGAAAATTTTGTTTAG
AATGAATTATAACTAAAATTTATTAGGATTGATGGTAAAGTTGCTCCTAAAGAGAGGCAC
GAAAGGGTTCAATAATTTTAAACAGACCCATAAGTAAAAGTTGCTATTCTATCTTTGTTA
GCTGCAAGTACTGGTCTGACATTAACAGCTTCCTCTAACATTGTTTTTGCAGAAATGAAT
TGGACACCTGCAATTATGCAGTAAGCAGAAGACAGAGCCCACAGAATTGGTTAAGAAAAC
AGTGTGCTATGTCATTATATTCTTGGAGAAAAAACACTTGATGACTTGCTTTACAAAAAA
ATAGAATAAAAAATAGCAATTGTAAGTAATATTCTTGACGGTGAATCTAAGGCTCTTAAG
ATAGACGAAGTATAAAAAGCAGAAAATGAAAATTAAATTATGGGTGATGATAATAATTAA
TATATAGAAGAAGATATTGAAGATTCTGCAAATGGGACATAAATGACCTAATAAAGATAA
ATGACTCAAGCTTAATTTTTACAATAATTGATACAAGAAAAAGAAAATAGAAAAATTTAA
AGTTCTTAGATTTCTGAGTAAATTAGCAATGCTGAGTCAACTGTCAATTAAAATTAAGTT
GAATAAGTTTTAAAACCTCTTAATATTTAAGTGAATAATAACTAATAATCTGAATCAGAA
AATAGTGATGATGACGAGGAAGAAGAACTTTTTATTCTTAAAATGATCGCCGCTTAGTCA
GCAAAAAGTTTAAAAGAAAAATAAAATAATATAGAAAAAAACTCAGTTATTAGTGATAAT
AATTAAAATAATGAAAAATTTAATCAAATGAGTGAAAAAACCAGTATTCAAAAAGAATAA
AATGATAAATAAATTCCTATTTTAGCTGAGATAAATGAAAAAATCTAAATAGAAGATGAC
GAAGCTGTAATTAATGAATATTAGATTAAAATAAGTGAAGAATGTAAAATACAAAAAAAT
GTTATCCCTTAAAAAGAAAGTAAGATACAATGTAATGATAATAAATATAATATACTTATC
AGCAGCATTGAAGATTCAAATATAAATCATGAATAAATAGATGATTATATCTATGATGAT
AACTAAAATTTAAGTATTGAATAAATTACATTATCGGTTGATAAATTAAACTCTACTGAA
AAAAAAGCTTAATAAAATCTAAGCACAAACAGTATTAATAATAATATATAAAAATTATAA
AATAATAATCTTAATACTATGAAAAATAATTAAAATCCCTAAGACTTGGAAACTTTTAAT
GAATTTTTATTCTCTTCTAGTAGTAAAAAGTAAAGCAATATCTTTTAGAAAAAAAGCGAA
ACAAAAAATAATGTTGAAAAGGAATAACAAGCAAATAAAATTAATAAATAAACTCCAAAA
GATAATAAAATTATACCAAAAACTGATGAATAAATCAGTACAAATAAAGTTGATAGCATA
AATAAATATCAATCTGATGAATTTTTTTATGATGATGAAGATTATTTTAATAGTATAAAG
CAGGATATTAAAACTAATAGTATTGATCTTTATAATTCTTAGTCTAAATAAAAAAACCCA
TCAGTTAATTTGACATAGAAATAGAAATAGTTTTTAAGGGCTGAAAACTACCAAAAAGGT
ATTAAAAAAATTATTTTTGACAATGGAGATGTTGAATATGTTTCTAGCTCAGAAGACTTA
GAATAATTTTATTCTAATAAGCTTGAAAGTAATGTTCAAAAAATAATTTCAAACAAACAA
GAAGAACCTAAATGTGATTATGATAGTGATGATGAATTATTTAGCTATTTAGATTAAAAC
TTCAGCTCTAAACAAGAATCTAATAAAGAACTTTCATATAGTAAGAGCAATTCTGATATA
TAATAACCTACAACTAGAAATGTAAGAAAAAGAGAAGATTTTGAATAAGATTTTGTAGAT
AGAAATGGAATTTCTGAATAAGATTGCAATTAAGTTTTTAATTAATTTTAACCATAAAAA
TAATCATCAATTTCAAAAAAATCACTTTTGAAATTAGCAAAGTAGCATTTTTGA


>TTHERM_01080500(protein)
MYFQQFQKGGYGNFNRQNSSNYNYNNNNNNVDKKQITIQLVQDNTILISGSYTSFTEQRK
DIIKKLGGSWDNDRKGWRCQYSQYNLIKQNIEKTGVEIQGIPDFVNSAIKSINEKLTFQT
DKKQYEILYNPEDINKKIENELPQKTVTNLYNFQKQGVQFGLKNNGRVLIADEMGVGKTI
QAICLASCYKSAWPLLIICPSSLKYNWKEEIVKWAYPPLKEMQVQILSKQAEEIYIMTRV
LIVSYDLAPKVEEKIKRFKTNIVIADEAHYLKNAQAKRTNSLLPILQKIKHVILLTGTPA
FARPKEMFTLLSIIRPDIFKTFKSFGDRYCDPKPARFGGGIDYTGSTNEKELFYILKKTI
MIRRLKQDVLSQLPSKRRKKVHVNVDPKILSEIQAILNQTNKSSLEQLFEQAQKQNESSN
EEQNGSSSMFSALSLCYQLSGQAKLHELKNYIKDLLENDIKIIVFAHHNEMLNQLENFVQ
NELQLKFIRIDGKVAPKERHERVQQFQTDPQVKVAILSLLAASTGLTLTASSNIVFAEMN
WTPAIMQQAEDRAHRIGQENSVLCHYILGEKTLDDLLYKKIEQKIAIVSNILDGESKALK
IDEVQKAENENQIMGDDNNQYIEEDIEDSANGTQMTQQRQMTQAQFLQQLIQEKENRKIQ
SSQISEQISNAESTVNQNQVEQVLKPLNIQVNNNQQSESENSDDDEEEELFILKMIAAQS
AKSLKEKQNNIEKNSVISDNNQNNEKFNQMSEKTSIQKEQNDKQIPILAEINEKIQIEDD
EAVINEYQIKISEECKIQKNVIPQKESKIQCNDNKYNILISSIEDSNINHEQIDDYIYDD
NQNLSIEQITLSVDKLNSTEKKAQQNLSTNSINNNIQKLQNNNLNTMKNNQNPQDLETFN
EFLFSSSSKKQSNIFQKKSETKNNVEKEQQANKINKQTPKDNKIIPKTDEQISTNKVDSI
NKYQSDEFFYDDEDYFNSIKQDIKTNSIDLYNSQSKQKNPSVNLTQKQKQFLRAENYQKG
IKKIIFDNGDVEYVSSSEDLEQFYSNKLESNVQKIISNKQEEPKCDYDSDDELFSYLDQN
FSSKQESNKELSYSKSNSDIQQPTTRNVRKREDFEQDFVDRNGISEQDCNQVFNQFQPQK
QSSISKKSLLKLAKQHF


>TTHERM_01080500(gene)
ATGTATTTTTAATGTAATTAATTAACTAGCAATTAAAATCATTTTATTAAAGCAATCTAC
CTAATAAAAATACATTTAAATAAAATTATAAAAAGAATTCTAGAAAGGTGGCTATGGGAA
TTTCAATCGATAAAATAGTAGCAATTATAACTATAATAATAACAATAATAATGTTGATGT
AAAACAAATATTATAGTATGAAAAATATTCTTATTTTTATTTAAAACAACTAGAAAAAAC
AAATAACTATTCAGCTTGTTTAAGATAATACAATACTTATCTCTGGTTCGTATACAAGCT
TTACAGAATAGAGAAAAGATATCATAAAAGTATTCAATAATTATTTTCAGCAATCCTAAC
ATCAAATTTTCATTTTAAATGCAGAAATTAGGAGGTTCTTGGGATAATGACAGAAAGGGA
TGGAGATGTTAATATTCATAATATAATCTTATAAAATAAAATGTAATTCTTGATATTTAC
TTCTAAAAATTATGAAAAATAAAATGACAAAATACAAATACAAACAATTTTAATATGCAA
TTTAACTAATATAAAAGATAGAAAAGACAGGTGTTGAAATTTAAGGAATACCAGATTTTG
TAAATAGTGCAATAAAGTCAATAAATGAAAAATTGACATTCCAAACAGATAAAAAATAAT
ATGAAATACTATATAATCCAGAAGACATAAATGTATAATTAAGCAAAAAAATTTTAATTA
GGCAATTAGCTATTGTAAAAATATATTTAAGAAAAAAATAGAAAATGAGCTACCACAAAA
AACAGTTACCAATCTGTATAATTTTCAAAAGCAAGGTGTGTAATTTGGGTTAAAAAATAA
CGGTAGAGTTCTCATAGCTGATGAAATGGTGAATAAAATTTTAATTAAAATAAAAAAATA
TTTAATACTATAAAAATAGGGTGTTGGTAAAACAATTCAGGCTATCTGTTTAGCAAGCTG
TTATAAATCTGCATGGCCGCTACTTATTATATGTCCATCTTCTTTAGTAAATAATATTTT
ATTTTACTTCAAAAATTTATTATTAAATTGATTTGAAACAAGTAAAATAGTTTTAGTTAT
TTAATATAAAAATAATTTCCTTTCATTTTATAAAGAAGATTTAAATTTGATAATTTCAAA
AATAAAAAAACACTTTTATTGAGTTTTTAAAAATTCTAATTTCTTTTTAAATACAAATAT
TTAGTAAAACAAATCAAATAATTTACTTTATTATGTTGAAATTTGATTAGTTTTAGTTTT
TAAGGATCTAATTAAAAAATTTATACAAGTTAAATAACTTAAAACGATAAATGGAATTAA
TTAAATAACAAGTTTACTTTGAATATTTATTTTTAAAAATTCAATAGTTATCTTTAAATT
TTAACTAAAAATCTTAGAAATAACAATAAATAAATAAGCTTTGATTTTATAACTGTTAAA
AGAATAAAATACAATCGAGAAATGATTAAGAAATGCATAAATATATAGAGTTAAATTTTT
ATTTCTTTAGCAATACACCTAAGCGAATAGCAACTTTATTAAAAATAATTTTTTACGGTT
TTTAAACTGAAAACTTTTAAATTAAAATTAGAAATATAATTGGAAAGAAGAAATTGTAAA
ATGGGCGTATCCTCCTCTTAAAGAAATGCAGGTTCAGATATTGTCAAAATAAGCAGAAGA
AATATATATAATGACTAGGGTTTTAATTGTCTCATATGATCTGGCTCCAAAAGTTGAAGA
AAAAATAAAAAGATTTAAAACTAATATTGTAATTGCAGATGAAGCTCATTACTTAAAGAA
CGCTTAAGCTAAAAGGACGAATAGTTTATTACCAATTCTTTAAAAAATAAAACATGTTAT
TCTTTTGACTGGTACTCCTGCATTTGCTAGACCAAAAGAAATGTTTACTCTTCTTTCTAT
TATTCGCCCTGATATATTTAAGACTTTCAAAAGTTTTGGAGATAGATATTGTGATCCCAA
ACCAGCTAGATTTGGAGGAGGAATAGATTACACTGGTTCCACTAATGAAAAAGAATTATT
CTATATTTTAAAGAAAACGATTATGATTAGGAGATTGAAATAAGATGTGCTCTCGTAATT
GCCTTCAAAGAGAAGAAAAAAAGTTCATGTTAACGTTGACCCAAAAATTTTATCAGAAAT
ATAAGCAATTCTTAATCAAACAAACAAAAGCTCTTTAGAATAACTGTTTGAGTAAGCTCA
AAAATAAAATGAGTCAAGCAATGAAGAATAAAATGGCTCTTCATCAATGTTTTCTGCTCT
TTCACTTTGCTACTAATTAAGTGGATAAGCCAAGTTACATGAATTAAAAAACTATATTAA
AGATTTATTGGAAAATGATATAAAAGTAAATAACTTCTTTAATTATTTTATCAGTTTTTA
TTCAGCACCAACTTTTAAATACTTATTTTTTTTATTAAAAAATTAAAAAGTTTATAAAAA
AATTTCGTTAAAGTTTTATAAAAACTAATCAGTATTCAAAATTTTTCTATAAACTTTAAC
TTATAATTTAGAATTTTTCCGTTTTTCTATTAAATAAATTATTGTTCTTATTTAAAAAAA
TAGATTATTGTATTTGCTCATCATAATGAAATGTTAAACTAGCTTGAAAATTTTGTTTAG
AATGAATTATAACTAAAATTTATTAGGATTGATGGTAAAGTTGCTCCTAAAGAGAGGCAC
GAAAGGGTTCAATAATTTTAAACAGACCCATAAGTAAAAGTTGCTATTCTATCTTTGTTA
GCTGCAAGTACTGGTCTGACATTAACAGCTTCCTCTAACATTGTTTTTGCAGAAGTAAAA
ACTTCATTATTAAAAAATAATATTCATTTAATAAAATTATTTTAGATGAATTGGACACCT
GCAATTATGCAGTAAGCAGAAGACAGAGCCCACAGAATTGGTTAAGAAAACAGTGTGCTA
TGTCATTATATTCTTGGAGAAAAAACACTTGATGACTTGCTTTACAAAAAAATAGAATAA
AAAATAGCAATTGTAAGTAATATTCTTGACGGTGAATCTAAGGCTCTTAAGATAGACGAA
GTATAAAAAGCAGAAAATGAAAATTAAATTATGGGTGATGATAATAATTAATATATAGAA
GAAGATATTGAAGATTCTGCAAATGGGACATAAATGACCTAATAAAGATAAATGACTCAA
GCTTAATTTTTACAATAATTGATACAAGAAAAAGAAAATAGAAAAATTTAAAGTTCTTAG
ATTTCTGAGTAAATTAGCAATGCTGAGTCAACTGTCAATTAAAATTAAGTTGAATAAGTT
TTAAAACCTCTTAATATTTAAGTGAATAATAACTAATAATCTGAATCAGAAAATAGTGAT
GATGACGAGGAAGAAGAACTTTTTATTCTTAAAATGATCGCCGCTTAGTCAGCAAAAAGT
TTAAAAGAAAAATAAAATAATATAGAAAAAAACTCAGTTATTAGTGATAATAATTAAAAT
AATGAAAAATTTAATCAAATGAGTGAAAAAACCAGTATTCAAAAAGAATAAAATGATAAA
TAAATTCCTATTTTAGCTGAGATAAATGAAAAAATCTAAATAGAAGATGACGAAGCTGTA
ATTAATGAATATTAGATTAAAATAAGTGAAGAATGTAAAATACAAAAAAATGTTATCCCT
TAAAAAGAAAGTAAGATACAATGTAATGATAATAAATATAATATACTTATCAGCAGCATT
GAAGATTCAAATATAAATCATGAATAAATAGATGATTATATCTATGATGATAACTAAAAT
TTAAGTATTGAATAAATTACATTATCGGTTGATAAATTAAACTCTACTGAAAAAAAAGCT
TAATAAAATCTAAGCACAAACAGTATTAATAATAATATATAAAAATTATAAAATAATAAT
CTTAATACTATGAAAAATAATTAAAATCCCTAAGACTTGGAAACTTTTAATGAATTTTTA
TTCTCTTCTAGTAGTAAAAAGTAAAGCAATATCTTTTAGAAAAAAAGCGAAACAAAAAAT
AATGTTGAAAAGGAATAACAAGCAAATAAAATTAATAAATAAACTCCAAAAGATAATAAA
ATTATACCAAAAACTGATGAATAAATCAGTACAAATAAAGTTGATAGCATAAATAAATAT
CAATCTGATGAATTTTTTTATGATGATGAAGATTATTTTAATAGTATAAAGCAGGATATT
AAAACTAATAGTATTGATCTTTATAATTCTTAGTCTAAATAAAAAAACCCATCAGTTAAT
TTGACATAGAAATAGAAATAGTTTTTAAGGGCTGAAAACTACCAAAAAGGTATTAAAAAA
ATTATTTTTGACAATGGAGATGTTGAATATGTTTCTAGCTCAGAAGACTTAGAATAATTT
TATTCTAATAAGCTTGAAAGTAATGTTCAAAAAATAATTTCAAACAAACAAGAAGAACCT
AAATGTGATTATGATAGTGATGATGAATTATTTAGCTATTTAGATTAAAACTTCAGCTCT
AAACAAGAATCTAATAAAGAACTTTCATATAGTAAGAGCAATTCTGATATATAATAACCT
ACAACTAGAAATGTAAGAAAAAGAGAAGATTTTGAATAAGATTTTGTAGATAGAAATGGA
ATTTCTGAATAAGATTGCAATTAAGTTTTTAATTAATTTTAACCATAAAAATAATCATCA
ATTTCAAAAAAATCACTTTTGAAATTAGCAAAGTAGCATTTTTGA