Identifiers and Description

Gene Model Identifier

TTHERM_01075640

Standard Name

HAP2 (HAPloid-disrupting mutant 2 homolog)

Aliases

PreTt02676 | 219.m00029 | GCS1

Description

Gamete fusion protein (HAP2/GCS1)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 61.7%

TetraMine Data

TTHERM_01075640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15340.19.997093137033517e-262hypothetical protein (752 aa)
DictyBaseDDB_G02760695.0012639607461234e-61hapA on chromosome: 2 position
6445628 to 6448087
OxytrichaContig20776.0.g622.000555387360374e-52Male gamete fusion factor
Stentor CoeruleusSteCoe_133551.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25247352: Orias E (2014) Membrane fusion: HAP2 protein on a short leash. Current biology : CB 24(18):R831-R833
  2. Ref:25155508: Cole ES, Cassidy-Hanley D, Fricke Pinello J, Zeng H, Hsueh M, Kolbin D, Ozzello C, Giddings T, Winey M, Clark TG (2014) Function of the male-gamete-specific fusion protein HAP2 in a seven-sexed ciliate. Current biology : CB 24(18):2168-2173

Sequences

>TTHERM_01075640(coding)
ATGAAATTTTTGGCTTTTGGATTGATTTATTTTCATTTTTGTATATTGAACAGGTGTGAG
TATATTACTTCTAGCACCATCCAAAAATGTTATAATTCTTCAAATGAACCAAATAACTGC
TCCTAAAAAGCTGTTATCGTCCTATCTTTAGAGAATGGATAAATAGCAAATACAGAACAA
GTAGTGGCCACTCTTAATCAGTTATCTGATAGTGGAGTAAATAAATAACTACAAAATAGT
TTTATTTTTGAGGTTACTAAATCTCCAGTGACTGCTCTATTTCCTCTTATTTACTTATAA
GATTTCAATAGCTAACCATTAGAGTAAGTGATCGCTACCACGCTATTTTCATGCAAGGAT
GGCTTTTATGATAGTAGTCCAACTTGTAAATTTTAGTATGACTCTAAAGGCTAAAAGATT
TTGGACAGCTAAGGTTATTGCTGCTATTGCTCTCTATCAGATATATTAGGCATGGGTAAT
GATCTATCAAGAGGTAAAGTGTGCTATGCTCTAAATCTTGGTGCAGGATCAGCAACAGCT
CACTGCCTAAAATTCAGTCCTCTTTGGTATTCTGCTTTTAAAATATAGCAATATTAGCTC
TACTTTGAAGTTAATATAAATATTTACACAGTTGATAGTCAAAACTAAAAAAATTTAAAA
CAAACTCTCAAACTTAGTACATCAAATCCTACAATGAAATCCTCTGATAATTCAACTATA
AGCAAAATTATAGGAACATTCACTCCAACATAACCTCCAGCTGATCTAAGTAGTTATTAC
CTTGTTAAACCAAGTTTTCCAGCTACAGATCCAAGAGTTCTTTAAGGGATAAGTTCTTGG
ATGTTTGTTGACAAAACCATGTTTACGCTGGATGGTACTTAGTGCAACAAAATTGGAGTC
AGCTACTCTGGTTTTAGATAATAATCCTCTAGCTGCTCATAGCCAGTAGGTTCTTGCCTT
TAAAATCAATTAGAGAACTTATATTAAAGTGATCTCATTCTTTTATCATAAAATAAATAA
CCTAAATATTTATTGGAATCACAAGGGAATTTTAACTAAGTGTAATTTCAAGGTTAGACA
ATCTTATAATAAGGGTTAAGTGGATCTGCTAGCACATTAATAACCATAGAAATAGATGCA
GCTTAAATAAAATTTGTAACTAATTTAGGAATAGGCTGCATTTCTCAATGTAGTATTAAT
AACTTCGAAAGTCATTCAGGTAATGGTAAACTAGTAGCTTTGGTTTAAAATTAAGGTAAT
TATAGTGCTGAATTTGTATTAGGCTTTAATTGTAGTTCGAATGTCTAGCCTATTTAAGGA
TAAAAGCTTTTTCTAACTGCAAATCAGCTATATAATTTTAATTGCTCAGTTTCAGTAAAT
AGTGATATAAGTGCTATAAATAACAATTGTACTATAAATTTATATGATGCAATAGGAAAT
TAGCTTGACTCTAAAAACATACTATTCAACACAACAAGCACCAATCATACAAGTAATTAA
GGAAATAACACAGGCTAGTAATAATCAAGCTAAGAATATAAGTCATCCTAATCCTGCAGT
GATAAATGTTCCAGTTTTTGGAGTTTTTGGTGCTATTTTTCTGCAGGATGCATTAAAGAG
GCATTTAAATCTATTGCTTCAATTGCAGGAGTAGCAAGTGCTCTAGCTCTGGTAATTTTT
TTGGCAAAAAATGGGTATTTAGTCCCTATTATTCGGTTTCTTTGCTGTTGCTGTTGCAAA
TCTAAGAAAAAGGAAAATGAAAAAAATAAAGACAAAACAGATAAAAAATCAATTTAAGAA
AGTTGCAGTTATGATAGATCGTGCTGCTCACATTCAATATCATAGTCATATTAGGTTGAA
AACAAAAATAAATATAAAAGATCTAAAATATAAAGAAGTTTTTCAAGTGAATCTTGTCAG
GATAAATCAAAGAAAATAATAAATGAATTATCAAACTTAGAAGAAACTTTCGAAGCCAAT
AAATTATATGCAAATATAGACAAAAACTCATCAATATTTGAATATTTCGGTTTTAAAAAA
TCATTTACATTTATTTTATATGAAAGAAATGATATTCTTTTCTTGCCTTAGAATAGCACA
ATCTTAGATATGATAGGAGCCTTATAGCCATAAAAAGGGTCATATTTAGCTCAAAAATTT
TTAGAAATAGTTAATAAAAACGCTCTAAAAGTTGTTTCAACATCTCCTCTCTATCTACTA
ATTGAATGA


>TTHERM_01075640(protein)
MKFLAFGLIYFHFCILNRCEYITSSTIQKCYNSSNEPNNCSQKAVIVLSLENGQIANTEQ
VVATLNQLSDSGVNKQLQNSFIFEVTKSPVTALFPLIYLQDFNSQPLEQVIATTLFSCKD
GFYDSSPTCKFQYDSKGQKILDSQGYCCYCSLSDILGMGNDLSRGKVCYALNLGAGSATA
HCLKFSPLWYSAFKIQQYQLYFEVNINIYTVDSQNQKNLKQTLKLSTSNPTMKSSDNSTI
SKIIGTFTPTQPPADLSSYYLVKPSFPATDPRVLQGISSWMFVDKTMFTLDGTQCNKIGV
SYSGFRQQSSSCSQPVGSCLQNQLENLYQSDLILLSQNKQPKYLLESQGNFNQVQFQGQT
ILQQGLSGSASTLITIEIDAAQIKFVTNLGIGCISQCSINNFESHSGNGKLVALVQNQGN
YSAEFVLGFNCSSNVQPIQGQKLFLTANQLYNFNCSVSVNSDISAINNNCTINLYDAIGN
QLDSKNILFNTTSTNHTSNQGNNTGQQQSSQEYKSSQSCSDKCSSFWSFWCYFSAGCIKE
AFKSIASIAGVASALALVIFLAKNGYLVPIIRFLCCCCCKSKKKENEKNKDKTDKKSIQE
SCSYDRSCCSHSISQSYQVENKNKYKRSKIQRSFSSESCQDKSKKIINELSNLEETFEAN
KLYANIDKNSSIFEYFGFKKSFTFILYERNDILFLPQNSTILDMIGALQPQKGSYLAQKF
LEIVNKNALKVVSTSPLYLLIE


>TTHERM_01075640(gene)
AATATAATAAAAAAAGAATAAAAATTATATTAACACATTCATAATATAAAAAATGAAATT
TTTGGCTTTTGGATTGATTTATTTTCATTTTTGTATATTGAACAGGTGTGAGTATATTAC
TTCTAGCACCATCCAAAAATGTTATAATTCTTCAAATGAACCAAATAACTGCTCCTAAAA
AGCTGTTATCGTCCTATCTTTAGAGAATGGATAAGTATTAATTATAGTTCTACTTTAGGT
TAAATAATTATTTTTATAGATAGCAAATACAGAACAAGTAGTGGCCACTCTTAATCAGTT
ATCTGATAGTGGAGTAAATAAATAACTACAAAATAGTTTTATTTTTGAGGTTACTAAATC
TCCAGTGACTGCTCTATTTCCTCTTATTTACTTATAAGATTTCAATAGCTAACCATTAGA
GTAAGTGATCGCTACCACGCTATTTTCATGCAAGGATGGCTTTTATGGTAATATTTATTC
GATTTCTTCAATAAATTAAATTTAAAATTAGATAGTAGTCCAACTTGTAAATTTTAGTAT
GACTCTAAAGGCTAAAAGATTTTGGACAGCTAAGGTTATTGCTGCTATTGCTCTCTATCA
GATATATTAGGCATGGGTAATGATCTATCAAGAGGTAAAGTGTGCTATGCTCTAAATCTT
GGTGCAGGTTATATATATTTATTAACTTAATTTATTAATTATTGATTAATTAGCCACTTA
TTTTTGACATTTTTATAATCTAAAAGGATCAGCAACAGCTCACTGCCTAAAATTCAGTCC
TCTTTGGTATTCTGCTTTTAAAATATAGCAATATTAGCTCTACTTTGAAGTTAATATAAA
TATTTACACAGTTGATAGTCAAAACTAAAAAAATTTAAAACAAACTCTCAAACTTAGTAC
ATCAAATCCTACAATGAAATCCTCTGATAATTCAACTATAAGCAAAATTATAGGAGTAAA
TTTTTTTAAGTTGTTAATATTTGCTAATTTATTTAATAAACAGACATTCACTCCAACATA
ACCTCCAGCTGATCTAAGTAGTTATTACCTTGTTAAACCAAGTTTTCCAGCTACAGATCC
AAGAGTTCTTTAAGGGATAAGTTCTTGGATGTTTGTTGACAAAACCATGTTTACGCTGGA
TGGTACTTAGTGCAACAAAATTGGAGTCAGCTACTCTGGTTTTAGATAATAATCCTCTAG
CTGCTCATAGCCAGTAGGTTCTTGCCTTTAAAATCAATTAGAGAACTTATATTAAAGTGA
TCTCATTCTTTTATCATAAAGTAGAATTAAAATTATGTTAATATCAACAAAATAAATGTT
ATAATTAAAATTTTAGCGAATTTATTTTAGTTAAATTAACTTAGTAAATTAAACATTTTT
TAAATATTAAAAATAAAATTTATTCGAAAAGATAAATAACCTAAATATTTATTGGAATCA
CAAGGGAATTTTAACTAAGTGTAATTTCAAGGTTAGACAATCTTATAATAAGGGTTAAGT
GGATCTGCTAGCACATTAATAACCATAGAAATAGATGCAGCTTAAATAAAATTTGTAACT
AATTTAGGAATAGGCTGCATTTCTCAATGTAGTATTAATAACTTCGAAAGTCATTCAGGT
AATGGTAAACTAGTAGCTTTGGTTTAAAATTAAGGTAATTATAGTGCTGAATTTGTATTA
GGCTTTAATTGTAGTTCGAATGTCTAGCCTATTTAAGGATAAAAGCTTTTTCTAACTGCA
AATCAGCTATATAATTTTAATTGCTCAGTTTCAGTAAATAGTGATATAAGTGCTATAAAT
AACAATTGTACTATAAATTTATATGATGCAATAGGAAATTAGCTTGACTCTAAAAACATA
CTATTCAACACAACAAGCACCAATCATACAAGTAAATATTAAATTATATTAATTTGAGAA
TAATTATTATGTAATTATGAAAAAGGTAATTAAGGAAATAACACAGGCTAGTAATAATCA
AGCTAAGAATATAAGTCATCCTAATCCTGCAGTGATAAATGTTCCAGTTTTTGGAGTTTT
TGGTGCTATTTTTCTGCAGGATGCATTAAAGAGGCATTTAAATCTATTGCTTCAATTGCA
GGAGTAGCAGTAAGTATTTCTTTTTATCCTTTATCAATGAAAAAATATTTATTAATTTTT
TAGAGTGCTCTAGCTCTGGTAATTTTTTTGGCAAAAAATGGGTATTTAGTCCCTATTATT
CGGTTTCTTTGCTGTTGCTGTTGCAAATCTAAGAAAAAGGAAAATGAAAAAAATAAAGAC
AAAACAGATAAAAAATCAATTTAAGAAAGTTGCAGTTATGATAGATCGTGCTGCTCACAT
TCAATATCATAGTCATATTAGGTTGAAAACAAAAATAAATATAAAAGATCTAAAATATAA
AGAAGTTTTTCAAGTGAATCTTGTCAGGATAAATCAAAGAAAATAATAAATGAATTATCA
AACTTAGAAGAAACTTTCGAAGCCAATAAATTATATGCAAATATAGACAAAAACTCATCA
ATATTTGAATATTTCGGTTTTAAAAAATCATTTACATTTATTTTATATGAAAGAAATGAT
ATTCTTTTCTTGCCTTAGAATAGCACAATCTTAGATATGGTATGATTGATTAAATTTTAT
ATACATTATTTTCTACTAAGAAAATTTTTAATTTTAATAATTTAGATAGGAGCCTTATAG
CCATAAAAAGGGTCATATTTAGCTCAAAAATTTTTAGAAATAGTTAATAAAAACGCTCTA
AAAGTTGTTTCAACATCTCCTCTCTATCTACTAATTGAATGAATGAAAAATATTTATTTA
TAATTTTTAATATTTTTGTATAAAATCATTAACATTTGAGACTCTTTTATAATTTATAAT
TCACATAAATTAACTTGTTAAAAGATTTATTTTCTAAAAGATTTAATTTCTGAAATATTA
CTTTATTTATGCTTAACTTGCTTTAATGTCTTAACCTTATTCGGGGTTTAATAGGTATAG
TATTAGCTTACTTTAAGCTCAACTTAATTTTAAATAATTTAATTATTTTAAATTCTCAAT
TTTCATGATTCTATCAATCGATCACTCGCTATT