Identifiers and Description

Gene Model Identifier

TTHERM_01075640

Standard Name

HAP2 (HAPloid-disrupting 2)

Aliases

PreTt02676 | 219.m00029 | GCS1

Description

HAP2 male gamete fusion factor; Gamete class II fusion protein (HAP2/GCS1); sex-specific target for blocking fertilization

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 61.7%

TetraMine Data

TTHERM_01075640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15340.19.997093137033517e-262hypothetical protein (752 aa)
DictyBaseDDB_G02760695.0012639607461234e-61hapA on chromosome: 2 position
6445628 to 6448087
OxytrichaContig20776.0.g622.000555387360374e-52Male gamete fusion factor
Stentor CoeruleusSteCoe_133551.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28238660: Pinello JF, Lai AL, Millet JK, Cassidy-Hanley D, Freed JH, Clark TG (2017) Structure-Function Studies Link Class II Viral Fusogens with the Ancestral Gamete Fusion Protein HAP2. Current biology : CB 27(5):651-660
  2. Ref:25247352: Orias E (2014) Membrane fusion: HAP2 protein on a short leash. Current biology : CB 24(18):R831-R833
  3. Ref:25155508: Cole ES, Cassidy-Hanley D, Fricke Pinello J, Zeng H, Hsueh M, Kolbin D, Ozzello C, Giddings T, Winey M, Clark TG (2014) Function of the male-gamete-specific fusion protein HAP2 in a seven-sexed ciliate. Current biology : CB 24(18):2168-2173

Sequences

>TTHERM_01075640(coding)
ATGAAATTTTTGGCTTTTGGATTGATTTATTTTCATTTTTGTATATTGAACAGGTGTGAG
TATATTACTTCTAGCACCATCCAAAAATGTTATAATTCTTCAAATGAACCAAATAACTGC
TCCTAAAAAGCTGTTATCGTCCTATCTTTAGAGAATGGATAAATAGCAAATACAGAACAA
GTAGTGGCCACTCTTAATCAGTTATCTGATAGTGGAGTAAATAAATAACTACAAAATAGT
TTTATTTTTGAGGTTACTAAATCTCCAGTGACTGCTCTATTTCCTCTTATTTACTTATAA
GATTTCAATAGCTAACCATTAGAGTAAGTGATCGCTACCACGCTATTTTCATGCAAGGAT
GGCTTTTATGATAGTAGTCCAACTTGTAAATTTTAGTATGACTCTAAAGGCTAAAAGATT
TTGGACAGCTAAGGTTATTGCTGCTATTGCTCTCTATCAGATATATTAGGCATGGGTAAT
GATCTATCAAGAGGTAAAGTGTGCTATGCTCTAAATCTTGGTGCAGGATCAGCAACAGCT
CACTGCCTAAAATTCAGTCCTCTTTGGTATTCTGCTTTTAAAATATAGCAATATTAGCTC
TACTTTGAAGTTAATATAAATATTTACACAGTTGATAGTCAAAACTAAAAAAATTTAAAA
CAAACTCTCAAACTTAGTACATCAAATCCTACAATGAAATCCTCTGATAATTCAACTATA
AGCAAAATTATAGGAACATTCACTCCAACATAACCTCCAGCTGATCTAAGTAGTTATTAC
CTTGTTAAACCAAGTTTTCCAGCTACAGATCCAAGAGTTCTTTAAGGGATAAGTTCTTGG
ATGTTTGTTGACAAAACCATGTTTACGCTGGATGGTACTTAGTGCAACAAAATTGGAGTC
AGCTACTCTGGTTTTAGATAATAATCCTCTAGCTGCTCATAGCCAGTAGGTTCTTGCCTT
TAAAATCAATTAGAGAACTTATATTAAAGTGATCTCATTCTTTTATCATAAAATAAATAA
CCTAAATATTTATTGGAATCACAAGGGAATTTTAACTAAGTGTAATTTCAAGGTTAGACA
ATCTTATAATAAGGGTTAAGTGGATCTGCTAGCACATTAATAACCATAGAAATAGATGCA
GCTTAAATAAAATTTGTAACTAATTTAGGAATAGGCTGCATTTCTCAATGTAGTATTAAT
AACTTCGAAAGTCATTCAGGTAATGGTAAACTAGTAGCTTTGGTTTAAAATTAAGGTAAT
TATAGTGCTGAATTTGTATTAGGCTTTAATTGTAGTTCGAATGTCTAGCCTATTTAAGGA
TAAAAGCTTTTTCTAACTGCAAATCAGCTATATAATTTTAATTGCTCAGTTTCAGTAAAT
AGTGATATAAGTGCTATAAATAACAATTGTACTATAAATTTATATGATGCAATAGGAAAT
TAGCTTGACTCTAAAAACATACTATTCAACACAACAAGCACCAATCATACAAGTAATTAA
GGAAATAACACAGGCTAGTAATAATCAAGCTAAGAATATAAGTCATCCTAATCCTGCAGT
GATAAATGTTCCAGTTTTTGGAGTTTTTGGTGCTATTTTTCTGCAGGATGCATTAAAGAG
GCATTTAAATCTATTGCTTCAATTGCAGGAGTAGCAAGTGCTCTAGCTCTGGTAATTTTT
TTGGCAAAAAATGGGTATTTAGTCCCTATTATTCGGTTTCTTTGCTGTTGCTGTTGCAAA
TCTAAGAAAAAGGAAAATGAAAAAAATAAAGACAAAACAGATAAAAAATCAATTTAAGAA
AGTTGCAGTTATGATAGATCGTGCTGCTCACATTCAATATCATAGTCATATTAGGTTGAA
AACAAAAATAAATATAAAAGATCTAAAATATAAAGAAGTTTTTCAAGTGAATCTTGTCAG
GATAAATCAAAGAAAATAATAAATGAATTATCAAACTTAGAAGAAACTTTCGAAGCCAAT
AAATTATATGCAAATATAGACAAAAACTCATCAATATTTGAATATTTCGGTTTTAAAAAA
TCATTTACATTTATTTTATATGAAAGAAATGATATTCTTTTCTTGCCTTAGAATAGCACA
ATCTTAGATATGATAGGAGCCTTATAGCCATAAAAAGGGTCATATTTAGCTCAAAAATTT
TTAGAAATAGTTAATAAAAACGCTCTAAAAGTTGTTTCAACATCTCCTCTCTATCTACTA
ATTGAATGA


>TTHERM_01075640(protein)
MKFLAFGLIYFHFCILNRCEYITSSTIQKCYNSSNEPNNCSQKAVIVLSLENGQIANTEQ
VVATLNQLSDSGVNKQLQNSFIFEVTKSPVTALFPLIYLQDFNSQPLEQVIATTLFSCKD
GFYDSSPTCKFQYDSKGQKILDSQGYCCYCSLSDILGMGNDLSRGKVCYALNLGAGSATA
HCLKFSPLWYSAFKIQQYQLYFEVNINIYTVDSQNQKNLKQTLKLSTSNPTMKSSDNSTI
SKIIGTFTPTQPPADLSSYYLVKPSFPATDPRVLQGISSWMFVDKTMFTLDGTQCNKIGV
SYSGFRQQSSSCSQPVGSCLQNQLENLYQSDLILLSQNKQPKYLLESQGNFNQVQFQGQT
ILQQGLSGSASTLITIEIDAAQIKFVTNLGIGCISQCSINNFESHSGNGKLVALVQNQGN
YSAEFVLGFNCSSNVQPIQGQKLFLTANQLYNFNCSVSVNSDISAINNNCTINLYDAIGN
QLDSKNILFNTTSTNHTSNQGNNTGQQQSSQEYKSSQSCSDKCSSFWSFWCYFSAGCIKE
AFKSIASIAGVASALALVIFLAKNGYLVPIIRFLCCCCCKSKKKENEKNKDKTDKKSIQE
SCSYDRSCCSHSISQSYQVENKNKYKRSKIQRSFSSESCQDKSKKIINELSNLEETFEAN
KLYANIDKNSSIFEYFGFKKSFTFILYERNDILFLPQNSTILDMIGALQPQKGSYLAQKF
LEIVNKNALKVVSTSPLYLLIE


>TTHERM_01075640(gene)
ATGAAATTTTTGGCTTTTGGATTGATTTATTTTCATTTTTGTATATTGAACAGGTGTGAG
TATATTACTTCTAGCACCATCCAAAAATGTTATAATTCTTCAAATGAACCAAATAACTGC
TCCTAAAAAGCTGTTATCGTCCTATCTTTAGAGAATGGATAAGTATTAATTATAGTTCTA
CTTTAGGTTAAATAATTATTTTTATAGATAGCAAATACAGAACAAGTAGTGGCCACTCTT
AATCAGTTATCTGATAGTGGAGTAAATAAATAACTACAAAATAGTTTTATTTTTGAGGTT
ACTAAATCTCCAGTGACTGCTCTATTTCCTCTTATTTACTTATAAGATTTCAATAGCTAA
CCATTAGAGTAAGTGATCGCTACCACGCTATTTTCATGCAAGGATGGCTTTTATGGTAAT
ATTTATTCGATTTCTTCAATAAATTAAATTTAAAATTAGATAGTAGTCCAACTTGTAAAT
TTTAGTATGACTCTAAAGGCTAAAAGATTTTGGACAGCTAAGGTTATTGCTGCTATTGCT
CTCTATCAGATATATTAGGCATGGGTAATGATCTATCAAGAGGTAAAGTGTGCTATGCTC
TAAATCTTGGTGCAGGTTATATATATTTATTAACTTAATTTATTAATTATTGATTAATTA
GCCACTTATTTTTGACATTTTTATAATCTAAAAGGATCAGCAACAGCTCACTGCCTAAAA
TTCAGTCCTCTTTGGTATTCTGCTTTTAAAATATAGCAATATTAGCTCTACTTTGAAGTT
AATATAAATATTTACACAGTTGATAGTCAAAACTAAAAAAATTTAAAACAAACTCTCAAA
CTTAGTACATCAAATCCTACAATGAAATCCTCTGATAATTCAACTATAAGCAAAATTATA
GGAGTAAATTTTTTTAAGTTGTTAATATTTGCTAATTTATTTAATAAACAGACATTCACT
CCAACATAACCTCCAGCTGATCTAAGTAGTTATTACCTTGTTAAACCAAGTTTTCCAGCT
ACAGATCCAAGAGTTCTTTAAGGGATAAGTTCTTGGATGTTTGTTGACAAAACCATGTTT
ACGCTGGATGGTACTTAGTGCAACAAAATTGGAGTCAGCTACTCTGGTTTTAGATAATAA
TCCTCTAGCTGCTCATAGCCAGTAGGTTCTTGCCTTTAAAATCAATTAGAGAACTTATAT
TAAAGTGATCTCATTCTTTTATCATAAAGTAGAATTAAAATTATGTTAATATCAACAAAA
TAAATGTTATAATTAAAATTTTAGCGAATTTATTTTAGTTAAATTAACTTAGTAAATTAA
ACATTTTTTAAATATTAAAAATAAAATTTATTCGAAAAGATAAATAACCTAAATATTTAT
TGGAATCACAAGGGAATTTTAACTAAGTGTAATTTCAAGGTTAGACAATCTTATAATAAG
GGTTAAGTGGATCTGCTAGCACATTAATAACCATAGAAATAGATGCAGCTTAAATAAAAT
TTGTAACTAATTTAGGAATAGGCTGCATTTCTCAATGTAGTATTAATAACTTCGAAAGTC
ATTCAGGTAATGGTAAACTAGTAGCTTTGGTTTAAAATTAAGGTAATTATAGTGCTGAAT
TTGTATTAGGCTTTAATTGTAGTTCGAATGTCTAGCCTATTTAAGGATAAAAGCTTTTTC
TAACTGCAAATCAGCTATATAATTTTAATTGCTCAGTTTCAGTAAATAGTGATATAAGTG
CTATAAATAACAATTGTACTATAAATTTATATGATGCAATAGGAAATTAGCTTGACTCTA
AAAACATACTATTCAACACAACAAGCACCAATCATACAAGTAAATATTAAATTATATTAA
TTTGAGAATAATTATTATGTAATTATGAAAAAGGTAATTAAGGAAATAACACAGGCTAGT
AATAATCAAGCTAAGAATATAAGTCATCCTAATCCTGCAGTGATAAATGTTCCAGTTTTT
GGAGTTTTTGGTGCTATTTTTCTGCAGGATGCATTAAAGAGGCATTTAAATCTATTGCTT
CAATTGCAGGAGTAGCAGTAAGTATTTCTTTTTATCCTTTATCAATGAAAAAATATTTAT
TAATTTTTTAGAGTGCTCTAGCTCTGGTAATTTTTTTGGCAAAAAATGGGTATTTAGTCC
CTATTATTCGGTTTCTTTGCTGTTGCTGTTGCAAATCTAAGAAAAAGGAAAATGAAAAAA
ATAAAGACAAAACAGATAAAAAATCAATTTAAGAAAGTTGCAGTTATGATAGATCGTGCT
GCTCACATTCAATATCATAGTCATATTAGGTTGAAAACAAAAATAAATATAAAAGATCTA
AAATATAAAGAAGTTTTTCAAGTGAATCTTGTCAGGATAAATCAAAGAAAATAATAAATG
AATTATCAAACTTAGAAGAAACTTTCGAAGCCAATAAATTATATGCAAATATAGACAAAA
ACTCATCAATATTTGAATATTTCGGTTTTAAAAAATCATTTACATTTATTTTATATGAAA
GAAATGATATTCTTTTCTTGCCTTAGAATAGCACAATCTTAGATATGGTATGATTGATTA
AATTTTATATACATTATTTTCTACTAAGAAAATTTTTAATTTTAATAATTTAGATAGGAG
CCTTATAGCCATAAAAAGGGTCATATTTAGCTCAAAAATTTTTAGAAATAGTTAATAAAA
ACGCTCTAAAAGTTGTTTCAACATCTCCTCTCTATCTACTAATTGAATGA