Identifiers and Description

Gene Model Identifier

TTHERM_01211770

Standard Name

GVT1 (Guanylate-binding/ER-golgi Vesicle Tethering 1)

Aliases

PreTt25498 | 275.m00020

Description

GVT1 amine-terminal domain guanylate-binding protein; Fusion of guanylate-binding protein and ER-golgi vesicle tethering protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF03528 ) Rabaptin
  • ( PF09204 ) Colicin D
  • ( PF02524 ) KID repeat
  • ( PF00261 ) Tropomyosin
  • ( PF01576 ) Myosin tail
  • ( PF06519 ) TolA protein
  • ( PF09311 ) Rab5 binding
  • ( PF02370 ) M protein repeat
  • ( PF04012 ) PspA/IM30 family
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00012 ) ribosomal protein L29
  • ( PF02344 ) Myc leucine zipper domain
  • ( PF04702 ) Vicilin N terminal region
  • ( PF01926 ) GTPase of unknown function
  • ( PF00038 ) Intermediate filament protein
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF09321 ) Domain of unknown function (DUF1978)
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF02263 ) Guanylate-binding protein, N-terminal domain
  • ( PF02841 ) Guanylate-binding protein, C-terminal domain
  • ( PF07106 ) Tat binding protein 1(TBP-1)-interacting protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01211770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_104160
Tetrahymena borealisEI9_17182.19.997093137033517e-262guanylate-binding protein doma
in-containing protein (1653 aa
)
OxytrichaContig20793.0.g609.997093137033517e-262Guanylate-binding protein, N-t
erminal domain
DictyBaseDDB_G02816396.0018235484001396e-36DDB_G0281639 on chromosome: 3
position 4746209 to 4748719
WormBaseWBGene000127631.0002869940498747e-21locus:atln-2 status:Confirme
d UniProt:O62433 protein_i
d:CAB09000.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01211770(coding)
ATGAATGAGATGAGGCTCAAACGAATAATGTCATCTGCATATAGAGAAGAAGCTATTCCA
TTTATTACTTATAATTCGGAGTAGAGAAAGTATTAGCTTTGCGAAGAAGCTGTTTAAATT
ATCAAGCAAGTTCCCAAGCCAATTGGTATTGTATCAGTTGCTGGTGCCTACAGAACAGGT
AAATCATACTTGTTGAATAGAATGATCCTCAACAGATCTGGCGGTTTTGGCGTCGGACCT
ACTGTAAATCCATGCACAAAGGGTATTTGGGTTTGGGGTACTCCTATCAAAGGACAAACT
CCTGAAGGCGATCCCGTCAATGTTTTAATTATGGACTCTGAAGGTATCGGCTCTACCGAT
GAAGATTAAACTCACGACACAAGAGTTTTTTCATTAGCAATTTTGCTCGCTTCTAATTTC
ATTTACAACTCCATGGGTGCAATCGATGAAAACGCATTAAACAACCTTTCCCTTGTTGTC
AATCTTACCAAGAACATTCACATCAAGTCCACTGATGGCGATGAACTTGATCAAGAAGAA
TACTCTAAATACTTCCCTAGTTTCTTCTGGGTTATCAGAGATTTCTCTCTCTAATTAGTT
GACACTGAAGGTGATCCCATCACTTCTAACGAATACTTAGAACGCGCTCTTTCAGAATAA
AAGGGCTATTCTGATGAAGTCGAATCTAAAAATAGAATCAGAAGACTCTTGAAGACATTT
TTCTAACAAAGAGAATGCATGACTTTGGTTAGACCCTTGGTTAACGAATAAAATTTATAA
AAGTTGGACAAGATGGAATTGGATGACTTGCGTCCTGAATTCTTTGAATAGGTCATTCAA
CTTAGAAAGAAAATTTTACAAAGAATTAAACCTAAGAATTTGAATGGAAAGTTATTAAAT
GGTGAAATGATCATGACTCTTTGTGATTCTTACGTCCGTGCCATCAATAACGGTGCTGTT
CCTAACATCGAAAATGCTTGGACTTATGTCTGCAAAGATGAATGTTACAAGGCCTCTCAA
AAAGCCTTTGAATCTTATGAAAAGACCATCAAAGAAATGATTGGATCTAAGATTCCAACC
ACCAACGATGAAATCAAGATTGCTCACAGAACAGCTAAAGAAACTGCTTTGGAAATTTTC
AAGAAGAGAGCTATTGGAGATGTCAGCAAGGAACACTTAGAAGAATTAAACAAGAAAATG
AAGGCTAGAGTTCAATAAATCAGAGCTACCAATGAAAAGGAAAGCTATTAGGAGTGTTAG
AACTTCATTAATAGGGAATTTGCCACCATTGATCGCAAGTTAAAGTCTAATCAATATAAA
AGATTCTCTGATTTTGAAAGTGACATTAAGCTTTTCTACAGTTTCTTGGTTAATCATGGT
CCAATTACTGTCAACAGAAACGTTATTTTCTTAGAATTCTTACAAAGAAGCATTAATGAA
GCTGCCAACATTTTTGTTAAGAATCTTGAATAGGAAGTTGATATTCAAAGATCTTGCAAC
AGCGAAGTCCAAAGAAGAAACGAAACTGAATTGGTTGAATTGAGAAAGAAAACTGATAAC
GAAAGAGTTCTTTTGGAAAGAAAGGTTGAACAATTGCTTAAGGAAAAGGATAGCATTGCA
ACTGATAAGGTTAAAAACGAAAGAGCTGTTAAGGAAATCGAAGAAGAAAAACAAAAGATG
GAAAAGGAATACAAGGAGCTCTTAAATTCTGAAAGAGTTGAATTAAATGATCAAATCAAC
AATTTGAGAAATAAGTCCAAGATCACTGAAGAGACTTTAAAGAAGGTTGAAAGAGAATTG
CTCTTAAAAGAAAGCTCCTTCCAAAAGGAAAAGGCTCTCCTTGAACAAAGAGCTCAACAC
TTTGAAAAGCTCTGCGAAGAATATCTTGCCAAGGACAAGGCTACTGAAAACATGATGCAA
TCAACTCACAGTGGATTCAACACTTAAATGAAGGAATAACAAACCAAATATGAACGCATT
ATTAAGGAATTGGAAAACAAGCTCACTAACTTGAAGGAATCTAACTTCGAATTAAATGAA
AAGATTTCCAACTAATCTTAAAACTTCAGCTAAGAAGTTGAAACCCTCCAAACTAGAGAA
CGTGGTTTACTCAGACAAATTGAAGAACTTCAAACTGAAATTTCTTCCACTAAGAAGTAA
CTCTCAGAAGCTAGCACCAATGGTCTTAAGAATTTGGGAGACTTGAAGGAGTAATTCAAT
AACGAAACCAATGACTTGAAGATTTAAAATACACAATTATAAGAAGAACTATCTAAGACT
CTTGATAAGCACAAACAAGACGTCTCAGAACTTCGTAAACGTGAAGCTCTTCTCCAATAA
CAAATTGAATTCGTTCGTCACGAATTAGATGAATCCCGTAGCTAACTCGTTGAAGCTAAG
AAGGCTCACGAATCTACTTTACAAGCTTTGGAAATCAACAATATGGGAGACGAAGAAAGC
GGCCAAAAGCAAATCTTGGAATTGAAGGACACTCACATGAAGTAAATCAGAGCCATGGAA
GCTGAAGCTCTTTCTTAAAAGAAGACTTTACAATCATAAATCGATGCTTTGAACAAGGAA
CTTAGCGACCTTGAATTGAAGTACAAGGTCTCCATTCATGACTATGAAACTGAAGTTAAA
ACTCTCAGCGACTAGTTAACTGAAAGCTAAGCTATCCGCACCCAATTATCTACTAAGCTC
TCTGAATCTGAAGAAATGCTCAAGCTCAGCTCTAAAGACATGGAAAAGAAATTCATCCAA
AAGATCCGTGAACTTGAAGACACCAATGAAGCCATCAAGGATAGATCTCAAAGCGAAATC
CGTGAAAATCAAGCCAAATCCGAAGAATCCTTACAACAATTAAAGAACATGTTCGAAATT
GAAAGAGAAACTTTGGAAAAGAGATTGATTGAAGAAAAGGAAAAGAGAGAAAAGAGCTAC
AACTAAGTTGTTGAAGAATATGAATAGAAATTAAGAGAAGAACAAGCTGCCTTGGAAGAA
GAAATCGAAAACTTGAGAGACGACATCAAGGACTACGAAATCTAAGTCATTAACATGCAA
GGCTAATACGAACACGAATTAGACTTGAAGTAGAAGACTATTGAAAACTTGGAAAAGATG
TTACAAGAAACCAAGGCTCAACTTTTAAGCAGCTAAGCTAGTTACTAATCTCAATTAGAA
TAACAAATGGCTTCTTATAATGCTGACAGAAAGGAATTACAACAAAAGTACGAAACTGTC
TAGAAGAACTTACAATTAAGTGATAACAAGATCCTCACATTAACTCAAAAGCTTGAAAGC
TCTGAAGCTAGCTATGAAAATAAGAAGAAGGAATTAGCTTAATTGAAACAAGACAACATT
ATCGAAAGATAAGCTCTTGAAGAAAAGCTTGAAGAAACTCGTAAGAAATATCAAGAATTA
TCTGATGAACACCTCCAAACAAAGATCAATTCTGAAAAATCTATTGCTCTCTCTTCTTAA
CAAAACGAATTCTACCAAAAGAAGGTTCAAGAATTACAAGTTGCTCTCGAATCTTCAACC
CAAAGATTTGAAGAACGTCTCAAGACTTCTAAAGCTGAATGGGCCTAAGAAACTCTTGAA
AAGATTCAAAATCTCCAAGATGAAAAGGTTAACTTGGAATCAAAGATCAACGCTTTGAAG
AAATCTACTAAAGAATTCGAAACTCAATACTAAAAGAGAGTCACCGATTTAGAAAAGGAA
AAGGCTATCTATGTCGAAAAACTCCAATACACTGAATCTAAGTTAAAAGAAACTGAAGAT
AAGTACATGATTGAAACTGAATAATTGAAGGATCAACTCTCCAAGGCTAAGGAATTCACA
TCAACTGAAAAGAAGATGCTCATTCAAGAAATTGAAAAGCTCAAATCATAGAACGTCTAA
CTTGATAATGAAAAGCATGAACTCAATACTTCTTATGAAAGAGATAAGGTTCTATGGGAA
GGAAAGTTCAGCTTCCTCCAATAACAAAAGGAGCAAGCCAAACAAGATTTAATCGAAGCT
CAAAAGAAATTCGAATAAACTCTTACTCACCTCTAAAAATAACGTCAAAACGAAAAGAAC
GAACGTGAACAAAGCGTTTCTGACATGCTCATGCAAATTGAAAGAAAATACCAAACTCAA
ATTTCTGAACTCCAAGAAACTTCCAACACCAAGCTCTCAGCTGCTAACCAAAAGATCACT
AAGCTCGAAGCTGAACTCAAGAACAGCTTGGATCAAACCATGATGGAATCACGTCAAAAG
AACTCCAATGCTATCTTCACCGAAAAGCGTCTTGCTGAACTTTTAGAAAGCGAAAAGAAG
CTTTCTTCTGAACTCGATATTATTCGTAAGGAACGTGAAGCTGAAAAGACCGAAGCCCAA
AGAAAGCTCGACCAAGAAAGAGAAACTCTTAAGACTAAGATGCTTCAAATTGAAGAAAAG
TTCAGAGAAGCTGAAAAGAAGAGAAACACTTTAATCTTCGAACATGAAAAGGAAAGAGCT
AAGTGGAATTTAGAAAAGGATCACTTACTCAATCAAAAGAATGAGCTCCAAGAAAACTTG
AACAAGATCGAAAAGAAGAAAGAAATCCTTTTGAGAGAAAACGAACGTCTTAAAAACGAT
TCTCGTCAATCAAGGAGATAAATGATGAACGCCAACTAACCTAGTTTCTTGAACATGAGC
AGAAACATGGGCAGTGAAAGAAAGAGTCCCATGAGAAGTGCTAGATCCAGAGAAAGAAGC
AGTTTGAACGACTACAGTTATGCCAACAATAGCGTTGACTGTGGTGAAGACAATGGCTCC
TCTGACAACAACACCAACAATATTTTGGAAAATCTTAACTTGAACTCCTCTCGCGAAAAC
CAACCTATCTAAAACACTCCCCCAGCTAACGGATTCAAGAGCTTCATGCAAGTTTTATAA
GAAAAGAGTGGACTCAACAATGAAAATAAGCCACCTGTATCCCCCTCTAAAAAGGAAAAC
GTCCTCATATGA


>TTHERM_01211770(protein)
MNEMRLKRIMSSAYREEAIPFITYNSEQRKYQLCEEAVQIIKQVPKPIGIVSVAGAYRTG
KSYLLNRMILNRSGGFGVGPTVNPCTKGIWVWGTPIKGQTPEGDPVNVLIMDSEGIGSTD
EDQTHDTRVFSLAILLASNFIYNSMGAIDENALNNLSLVVNLTKNIHIKSTDGDELDQEE
YSKYFPSFFWVIRDFSLQLVDTEGDPITSNEYLERALSEQKGYSDEVESKNRIRRLLKTF
FQQRECMTLVRPLVNEQNLQKLDKMELDDLRPEFFEQVIQLRKKILQRIKPKNLNGKLLN
GEMIMTLCDSYVRAINNGAVPNIENAWTYVCKDECYKASQKAFESYEKTIKEMIGSKIPT
TNDEIKIAHRTAKETALEIFKKRAIGDVSKEHLEELNKKMKARVQQIRATNEKESYQECQ
NFINREFATIDRKLKSNQYKRFSDFESDIKLFYSFLVNHGPITVNRNVIFLEFLQRSINE
AANIFVKNLEQEVDIQRSCNSEVQRRNETELVELRKKTDNERVLLERKVEQLLKEKDSIA
TDKVKNERAVKEIEEEKQKMEKEYKELLNSERVELNDQINNLRNKSKITEETLKKVEREL
LLKESSFQKEKALLEQRAQHFEKLCEEYLAKDKATENMMQSTHSGFNTQMKEQQTKYERI
IKELENKLTNLKESNFELNEKISNQSQNFSQEVETLQTRERGLLRQIEELQTEISSTKKQ
LSEASTNGLKNLGDLKEQFNNETNDLKIQNTQLQEELSKTLDKHKQDVSELRKREALLQQ
QIEFVRHELDESRSQLVEAKKAHESTLQALEINNMGDEESGQKQILELKDTHMKQIRAME
AEALSQKKTLQSQIDALNKELSDLELKYKVSIHDYETEVKTLSDQLTESQAIRTQLSTKL
SESEEMLKLSSKDMEKKFIQKIRELEDTNEAIKDRSQSEIRENQAKSEESLQQLKNMFEI
ERETLEKRLIEEKEKREKSYNQVVEEYEQKLREEQAALEEEIENLRDDIKDYEIQVINMQ
GQYEHELDLKQKTIENLEKMLQETKAQLLSSQASYQSQLEQQMASYNADRKELQQKYETV
QKNLQLSDNKILTLTQKLESSEASYENKKKELAQLKQDNIIERQALEEKLEETRKKYQEL
SDEHLQTKINSEKSIALSSQQNEFYQKKVQELQVALESSTQRFEERLKTSKAEWAQETLE
KIQNLQDEKVNLESKINALKKSTKEFETQYQKRVTDLEKEKAIYVEKLQYTESKLKETED
KYMIETEQLKDQLSKAKEFTSTEKKMLIQEIEKLKSQNVQLDNEKHELNTSYERDKVLWE
GKFSFLQQQKEQAKQDLIEAQKKFEQTLTHLQKQRQNEKNEREQSVSDMLMQIERKYQTQ
ISELQETSNTKLSAANQKITKLEAELKNSLDQTMMESRQKNSNAIFTEKRLAELLESEKK
LSSELDIIRKEREAEKTEAQRKLDQERETLKTKMLQIEEKFREAEKKRNTLIFEHEKERA
KWNLEKDHLLNQKNELQENLNKIEKKKEILLRENERLKNDSRQSRRQMMNANQPSFLNMS
RNMGSERKSPMRSARSRERSSLNDYSYANNSVDCGEDNGSSDNNTNNILENLNLNSSREN
QPIQNTPPANGFKSFMQVLQEKSGLNNENKPPVSPSKKENVLI


>TTHERM_01211770(gene)
ATGAATGAGATGAGGCTCAAACGAATAGTGTGATTTTTATTTGAAAGATATTGAAAAATG
AATTGAAATATGAATAGAAAAAAAACACATAGATATTTATATATATATTGATACATAGAT
AAAGATGATAATACATAATTAAATGAATAAAGAGAGTTAATAATAGATAAGGAAATGGGA
AGTTTTTATTGTTTCTTTATTAATTTATTTATTTATCTTTGATTATAGTCTGTTTAATTG
TTTGTTAACTGCACATTTAAATTTTGATAAAGTTGCTGTGTTCAGATGAAAAAAAATTTA
AAATTGAAAAAAATATTAAATATTTTGTTTTTCTTGAAAAAAGAAGATAACAAACAAACA
AACAAAAATCAAAAGAAGAGAAAAGCGTAAGTATTAAATAAAGTAAAGAAAAAGGGATTG
ATTAATAAACTATCTCTGAAGATCTCAACTAATAAAGAAAACCACAAATACGCATAAGAT
AAAAACATAAAATTAGCAAGATGTCATCTGCATATAGAGAAGAAGCTATTCCATTTATTA
CTTATAATTCGGAGTAGAGAAGTACACTATTTATTTATCCTCATTTTTTCAACATTTTTA
ATCCTCCTTTCTTTATTTAGAGTATTAGCTTTGCGAAGAAGCTGTTTAAATTATCAAGCA
AGTTCCCAAGCCAATTGGTATTGTATCAGTTGCTGGTGCCTACAGAACAGGTAAATCATA
CTTGTTGAATAGAATGATCCTCAACAGATCTGGCGGTTTTGGCGTCGGACCTACTGTAAA
TCCATGCACAAAGGTAAAAAATAAATAATTGCTTATTGATAAATTTTCTATCTACTTTGC
TTATTTATTTAAACACAAAATTTGAATATAAATTATAAATAAATAGGGTATTTGGGTTTG
GGGTACTCCTATCAAAGGACAAACTCCTGAAGGCGATCCCGTCAATGTTTTAATTATGGA
CTCTGAAGGTATCGGCTCTACCGATGAAGATTAAACTCACGACACAAGAGTTTTTTCATT
AGCAATTTTGCTCGCTTCTAATTTCATTTACAACTCCATGGGTGCAATCGATGTAATACA
TAATTAATTAATTGCTTCTAATAACTAATCCTAGAAAAAGGCAAATTTAAATTAAGATGT
AAATTTATGAATTAATAGGAAAACGCATTAAACAACCTTTCCCTTGTTGTCAATCTTACC
AAGAACATTCACATCAAGTCCACTGATGGCGATGAACTTGATCAAGAAGGTATTTAAAAT
TAACAAATAAACACATATTGCTTGTTTGCTTTTTTGTTTGCTTTGATTGAGGAATATATA
AAAAGTTAAATTGATTAGTCACAAATTCAAAAAAAGCAATGCAAATTAAGCAAAATAGTT
AATTAAATATAGGCTTTATTAAAATATAAGAAAATTTATCAAAAATTTTAGAATTTGATT
TAAATAAGATTTATTTGAATTCATCTATTGATTAAATCAGTGAATGAATGAATGAATGAA
TGAATAGTGACTTTCAGTTTAAAATAAAACAAAGCAAAACAAAATAAAACAACAACTGTA
TTCATTTTTAAATAATTAATTATCTTTTAATTAAATAAATAAATAGAATACTCTAAATAC
TTCCCTAGTTTCTTCTGGGTTATCAGAGATTTCTCTCTCTAATTAGTTGACACTGAAGGT
GATCCCATCACTTCTAACGAATACTTAGAACGCGCTCTTTCAGGTAATAATTTAGACATT
CTTTCATTACTCAAACAAACAAACAAATAAATAATTGAGATCAGCCAGCCATAAATTTAA
TTAAATAAAATATAAATTTATTTGAGAAGATTTATTCGAAATTAATTTCTATCTTAAAAA
AATTTTTAATTCTACTATTTTAATTAACTTCTTTCTTCATTCTTAGAGATAGAAAATAAT
TTTTTGATAATTAGAATAAAAGGGCTATTCTGATGAAGTCGAATCTAAAAATAGAATCAG
AAGACTCTTGAAGACATTTTTCTAACAAAGAGAATGCATGACTTTGGTTAGACCCTTGGT
TAACGAATAAAATTTATAAAAGTTGGACAAGATGGAATTGGATGACTTGCGTCCTGAATT
CTTTGAATAGGTCATTCAACTTAGAAAGAAAATTTTACAAAGAATTAAACCTAAGAATTT
GAATGGAAAGTTATTAAATGGTGAAATGATCATGACTCTTTGTGATTCTTACGTCCGTGC
CATCAATAACGGTGCTGTTCCTAACATCGAAAATGCTTGGACTTATGTCTGCAAAGATGA
ATGTTACAAGGCCTCTCAAAAAGCCTTTGAATCTTATGAAAAGACCATCAAAGAAATGAT
TGGATCTAAGATTCCAACCACCAACGATGAAATCAAGGTAATTTAAATTAAATTAAATCA
AAGCAATTCATTTAATTTTATTCAAATCAAATCAAATTGAATAATTTATTTCTTTATTTT
GTTGTTTGTTTTGAGATGAGTTTTAAAAATAATTCATTTGCTTTCAATTTAAATGAAGAA
AATTTAAATTTTACTTGGGAAATTTGAATTAGCCATTTATTTATTTTGATCACCCAGTAA
AATAAATACAAATGTTAAAATAGAAAAGAAAGAAAGAAAGTGAATTTCAAAAAGCTTACA
ACGAATTAAATTATTAAATAAATTTATTCTTCATTCATTCATTCAATTAATTAAATTATT
AATTAATCTAATTAGATTGCTCACAGAACAGCTAAAGAAACTGCTTTGGAAATTTTCAAG
AAGAGAGCTATTGGAGATGTCAGCAAGGAACACTTAGAAGAATTAAACAAGAAAATGAAG
GCTAGAGTTCAATAAATCAGAGCTACCAATGAAAAGGAAAGCTATTAGGAGTGTTAGAAC
TTCATTAATAGGGAATTTGCCACCATTGATCGCAAGTTAAAGTCTAATCAATATAAAAGA
TTCTCTGATTTTGAAAGTGACATTAAGCTTTTCTACAGTTTCTTGGTTAATCATGGTCCA
ATTACTGTCAACAGAAACGTTATTTTCTTAGAATTCTTACAAAGAAGCATTAATGAAGCT
GCCAACATTTTTGTTAAGAATCTTGAATAGGAAGTTGATATTCAAAGAGTAATTTATTTA
TTTATTTTTTGAGCTTAGAAAATAATTTTATGCTAAATTAAATTAATTTTTATTAGTCTT
GCAACAGCGAAGTCCAAAGAAGAAACGAAACTGAATTGGTTGAATTGAGAAAGAAAACTG
ATAACGAAAGAGTTCTTTTGGAAAGAAAGGTTGAACAATTGCTTAAGGAAAAGGATAGCA
TTGCAACTGATAAGGTTAAAAACGAAAGAGCTGTTAAGGAAATCGAAGAAGAAAAACAAA
AGATGGAAAAGGAATACAAGGAGCTCTTAAATTCTGAAAGAGTTGAATTAAATGATCAAA
TCAACAATTTGAGAAATAAGTCCAAGATCACTGAAGAGACTTTAAAGAAGGTTGAAAGAG
AATTGCTCTTAAAAGAAAGCTCCTTCCAAAAGGAAAAGGCTCTCCTTGAACAAAGAGCTC
AACACTTTGAAAAGCTCTGCGAAGAATATCTTGCCAAGGACAAGGCTACTGAAAACATGA
TGCAATCAACTCACAGTGGATTCAACACTTAAATGAAGGAATAACAAACCAAATATGAAC
GCATTATTAAGGAATTGGAAAACAAGCTCACTAACTTGAAGGAATCTAACTTCGAATTAA
ATGAAAAGATTTCCAACTAATCTTAAAACTTCAGCTAAGAAGTTGAAACCCTCCAAACTA
GAGAACGTGGTTTACTCAGACAAATTGAAGAACTTCAAACTGAAATTTCTTCCACTAAGA
AGTAACTCTCAGAAGCTAGCACCAATGGTCTTAAGAATTTGGGAGACTTGAAGGAGTAAT
TCAATAACGAAACCAATGACTTGAAGATTTAAAATACACAATTATAAGAAGAACTATCTA
AGACTCTTGATAAGCACAAACAAGACGTCTCAGAACTTCGTAAACGTGAAGCTCTTCTCC
AATAACAAATTGAATTCGTTCGTCACGAATTAGATGAATCCCGTAGCTAACTCGTTGAAG
CTAAGAAGGCTCACGAATCTACTTTACAAGCTTTGGAAATCAACAATATGGGAGACGAAG
AAAGCGGCCAAAAGCAAATCTTGGAATTGAAGGACACTCACATGAAGTAAATCAGAGCCA
TGGAAGCTGAAGCTCTTTCTTAAAAGAAGACTTTACAATCATAAATCGATGCTTTGAACA
AGGAACTTAGCGACCTTGAATTGAAGTACAAGGTCTCCATTCATGACTATGAAACTGAAG
TTAAAACTCTCAGCGACTAGTTAACTGAAAGCTAAGCTATCCGCACCCAATTATCTACTA
AGCTCTCTGAATCTGAAGAAATGCTCAAGCTCAGCTCTAAAGACATGGAAAAGAAATTCA
TCCAAAAGATCCGTGAACTTGAAGACACCAATGAAGCCATCAAGGATAGATCTCAAAGCG
AAATCCGTGAAAATCAAGCCAAATCCGAAGAATCCTTACAACAATTAAAGAACATGTTCG
AAATTGAAAGAGAAACTTTGGAAAAGAGATTGATTGAAGAAAAGTAATTTTTTATCATCA
TTTTTAATTCATTTTTTAAATATATTTTATTTGTTTTTAAATTTAATTTAATTTTTTTAA
ATAGGGAAAAGAGAGAAAAGAGCTACAACTAAGTTGTTGAAGAATATGAATAGAAATTAA
GAGAAGAACAAGCTGCCTTGGAAGAAGAAATCGAAAACTTGAGAGACGACATCAAGGACT
ACGAAATCTAAGTCATTAACATGCAAGGCTAATACGAACACGAATTAGACTTGAAGTAGA
AGACTATTGAAAACTTGGAAAAGATGTTACAAGAAACCAAGGCTCAACTTTTAAGCAGCT
AAGCTAGTTACTAATCTCAATTAGAATAACAAATGGCTTCTTATAATGCTGACAGAAAGG
AATTACAACAAAAGTACGAAACTGTCTAGAAGAACTTACAATTAAGTGATAACAAGATCC
TCACATTAACTCAAAAGCTTGAAAGCTCTGAAGCTAGCTATGAAAATAAGAAGAAGGAAT
TAGCTTAATTGAAACAAGACAACATTATCGAAAGATAAGCTCTTGAAGAAAAGCTTGAAG
AAACTCGTAAGAAATATCAAGAATTATCTGATGAACACCTCCAAACAAAGATCAATTCTG
AAAAATCTATTGCTCTCTCTTCTTAACAAAACGAATTCTACCAAAAGAAGGTTCAAGAAT
TACAAGTTGCTCTCGAATCTTCAACCCAAAGATTTGAAGAACGTCTCAAGACTTCTAAAG
CTGAATGGGCCTAAGAAACTCTTGAAAAGATTCAAAATCTCCAAGATGAAAAGGTTAACT
TGGAATCAAAGATCAACGCTTTGAAGAAATCTACTAAAGAATTCGAAACTCAATACTAAA
AGAGAGTCACCGATTTAGAAAAGGAAAAGGCTATCTATGTCGAAAAACTCCAATACACTG
AATCTAAGTTAAAAGAAACTGAAGATAAGTACATGATTGAAACTGAATAATTGAAGGATC
AACTCTCCAAGGCTAAGGAATTCACATCAACTGAAAAGAAGATGCTCATTCAAGAAATTG
AAAAGCTCAAATCATAGAACGTCTAACTTGATAATGAAAAGCATGAACTCAATACTTCTT
ATGAAAGAGATAAGGTTCTATGGGAAGGAAAGTTCAGCTTCCTCCAATAACAAAAGGAGC
AAGCCAAACAAGATTTAATCGAAGCTCAAAAGAAATTCGAATAAACTCTTACTCACCTCT
AAAAATAACGTCAAAACGAAAAGAACGAACGTGAACAAAGCGTTTCTGACATGCTCATGC
AAATTGAAAGAAAATACCAAACTCAAATTTCTGAACTCCAAGAAACTTCCAACACCAAGC
TCTCAGCTGCTAACCAAAAGATCACTAAGCTCGAAGCTGAACTCAAGAACAGCTTGGATC
AAACCATGATGGAATCACGTCAAAAGAACTCCAATGCTATCTTCACCGAAAAGCGTCTTG
CTGAACTTTTAGAAAGCGAAAAGAAGCTTTCTTCTGAACTCGATATTATTCGTAAGGAAC
GTGAAGCTGAAAAGACCGAAGCCCAAAGAAAGCTCGACCAAGAAAGAGAAACTCTTAAGA
CTAAGATGCTTCAAATTGAAGAAAAGGTAAATAAAAATAAATTAAAAAAAATCATTTATT
TAAATAAATTCAAATTAATAAATTAATAGTTCAGAGAAGCTGAAAAGAAGAGAAACACTT
TAATCTTCGAACATGAAAAGGAAAGAGCTAAGTGGAATTTAGAAAAGGATCACTTACTCA
ATCAAAAGAATGAGCTCCAAGAAAACTTGAACAAGATCGAAAAGAAGAAAGAAATCCTTT
TGAGAGAAAACGAACGTCTTAAAAACGATTCTCGTCAATCAAGGAGGTAATTTGAAAGAT
TATCTGATTAAAATTCTAATATTTTCTTGACATAAAATAGATAAATGATGAACGCCAACT
AACCTAGTTTCTTGAACATGAGCAGAAACATGGGCAGTGAAAGAAAGAGTCCCATGAGAA
GTGCTAGATCCAGAGAAAGAAGCAGTTTGAACGACTACAGTTATGCCAACAATAGCGTTG
ACTGTGGTGAAGACAATGGCTCCTCTGACAACAACACCAACAATATTTTGGAAAATCTTA
ACTTGAACTCCTCTCGCGAAAACCAACCTATCTAAAACACTCCCCCAGCTAACGGATTCA
AGAGCTTCATGCAAGTTTTATAAGAAAAGAGTGGACTCAACAATGAAAATAAGCCACCTG
TATCCCCCTCTAAAAAGGAAAACGTCCTCATATGA