Identifiers and Description

Gene Model Identifier

TTHERM_00998830

Standard Name

GUF1 (Gene of Uncertain Friendliness 1)

Aliases

PreTt26062 | 189.m00040 | 3819.m00198

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00998830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19788.19.997441244797434e-45hypothetical protein (569 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00998830(coding)
ATGAATTAGTGTATTTAAGAGTAAATAGAAAACTCAAATGTTCAAGCTGTTGTAGAAGCT
ATTGTGTTTAAAAAATACTCTAGAAGTAGAAGACAAATTTCTTATCTTTCTTAGATAACT
ATTGGGGAACAGTAAGGTTTTATTATTTTGGAGTAAGAATAAATAGAATAAATTATTTCT
GAAAATTTACTGGCAAACCGAATTGAGGTTTATGAATATGAATTGAGCTAATCAATATTT
TAAAAAGAACTAAAAAAGTATTTAGCCACAAATGACTCATTAAATAATAATCAGCAAGGC
TCAAATGAATAATAAAAGATAAACTAATAAGAACATGAGCTGAATGATTTTGAGCTTGAG
AGTAATAAAGTTAATGTATCTTTGTAAAGAGAATAATAAATTTTTAGTGATTTTGAAGGT
GAAAATATATGTGATGAGAAAAATATTTTGAATTAAGAAGAGATTTAACTCAGCGAAAAT
TTATAAGAGAAAGATGCTGCAGAAAATTTAGGGTTTATTGAAGAAAACTATGCTTAAAAA
GAATCTAACACAAACAAAGACTAATAAGGTGATTAAGAGTAATTTAATGAATAATATATG
CAGGCTGAAGACTTAGTTATAAATATTCAATCTCACTATTAAGAATAAGAGACTGAATAA
TTCCATGAATAATTGGAAGAATAATCGAAGCATGAATTAACTAACAAAGAATCTAATAAT
TTTATTGAAGAAAATATCCTAAATGCAAATTTAGTATAAAAAGAAAATGAAAATTTGGAA
TCAACAAATGAAAATAAGTGCTAAAATGAGTAAGAATAAAACCATTCACAATAAGATAAT
TAATAATAAATGTAATTGTAATAAAATAATTATGAATAAAAGTAATTTCAATAAGATAAT
TAAGAATTGATAAATAAGCAAGATTAGCTATGTCAAAATAATATAAATTACCACACTTAA
TTTTTAAAATAAGATAATTATTAATTTCAACAGCAGCAATAGAATGGATAATAACAAAAT
TTGTAATATACAATTTAATAAATATTCAATCAAGAAAATGATAGTGATAGTTAATCTTCC
TAGCATAATAATAAATCTCCTCAAATTGAAATTAATGCTTAAGAAGCTTAGCTTGATTAA
AGCAAGAAACAAAGTCATTAGAATTCAAGTATGAATCTGTCTTAAGGTAAAATGCACGGA
TAAAATAGTTAAGGAAAAAATTAAAATTTTTAGTTAAGTCAGAGTATTTAATTAGTAAAT
TTAATAGATGAAACTTCTCAATAATAAGATAGAAAACTAGAATTTGACTCTAAAATTGAA
GATGAATCGATTCTATAGTAATAATAATAATAATAAAGCTAATCATAAGCTTTAAGCTAA
CAAAAAGAAGAAAAGATCATTGAAAACTTTGAACTTAGTGAAGTAAAAAGCGAGGATGTG
AATTTATTAATTTAGAGTAAAGACAAATTTTTAGTTTCACAAGCTTAAGATACAAAAACA
GAATTAGAAAGCCAGTCATCAGAACTTCTTAATTTAATCAATTAAAAGGAAAAACTACAA
AAAAATGCTTAAATTGATAAAAAATTTTCTGAAAAAATTTACTAAAAAAGGTAAGTCAGT
CAAATAAAATAAGATAATAAATAAAATAATTTAGACTTAAATAACAACAATAGACGTAAT
ATTTAAAGCACGAATGTAAAAAATTAGCAAAATTCAATCGTTTTAAAAAATGATCAAGAG
ATTTTTAAGATGCCAACCAAAACACAAAAATCAAGATAATAAAATGAAAATCTATCTCAA
AAACAAAAATAGGCAAGTAAAAGCAATCTCTGTTTAATCGAAATTGATTCAGACGATTAT
ATTTGTGTGGATAACAAAAATTATAAAGTACTTTAAAAGCCCAAAGAAGTAACGATACAG
CCTTCAATTTCAGAAATAGATTAATTTCATTCTTTAGAGAGCCATGATTTAATTAAAAAA
AGTAAAGAACAAATAAAAATAACAAAATAAATTGGAGCTATGAAATATTTGGTTAATGAG
TTGAGTAACAAAAATTAATATGGGTAATTTTCTAAAGACAAGGCAGACATTATAATTAAC
CATAAACTAAATATTCGTGAATAACACTAAGACGAAGTTTATACACAATTCAACATTACC
AAATGCTTATATAAAGTTACATGGAAAAAAAGACCTTCTGGAAGAATTCCTCAACCCAGT
TATTTCACTTTCAACGAACTATATCAAGTGGCTCCAAGGTTACTTCTAGAATATCTAAAG
AAAATGGCAACACTGAAAGTGTGA


>TTHERM_00998830(protein)
MNQCIQEQIENSNVQAVVEAIVFKKYSRSRRQISYLSQITIGEQQGFIILEQEQIEQIIS
ENLLANRIEVYEYELSQSIFQKELKKYLATNDSLNNNQQGSNEQQKINQQEHELNDFELE
SNKVNVSLQREQQIFSDFEGENICDEKNILNQEEIQLSENLQEKDAAENLGFIEENYAQK
ESNTNKDQQGDQEQFNEQYMQAEDLVINIQSHYQEQETEQFHEQLEEQSKHELTNKESNN
FIEENILNANLVQKENENLESTNENKCQNEQEQNHSQQDNQQQMQLQQNNYEQKQFQQDN
QELINKQDQLCQNNINYHTQFLKQDNYQFQQQQQNGQQQNLQYTIQQIFNQENDSDSQSS
QHNNKSPQIEINAQEAQLDQSKKQSHQNSSMNLSQGKMHGQNSQGKNQNFQLSQSIQLVN
LIDETSQQQDRKLEFDSKIEDESILQQQQQQQSQSQALSQQKEEKIIENFELSEVKSEDV
NLLIQSKDKFLVSQAQDTKTELESQSSELLNLINQKEKLQKNAQIDKKFSEKIYQKRQVS
QIKQDNKQNNLDLNNNNRRNIQSTNVKNQQNSIVLKNDQEIFKMPTKTQKSRQQNENLSQ
KQKQASKSNLCLIEIDSDDYICVDNKNYKVLQKPKEVTIQPSISEIDQFHSLESHDLIKK
SKEQIKITKQIGAMKYLVNELSNKNQYGQFSKDKADIIINHKLNIREQHQDEVYTQFNIT
KCLYKVTWKKRPSGRIPQPSYFTFNELYQVAPRLLLEYLKKMATLKV


>TTHERM_00998830(gene)
AAATTATAATATTTATTTATTTGTAATATCTCGAGTAAAAAAATTAAAATGAATTAGTGT
ATTTAAGAGTAAATAGAAAACTCAAATGTTCAAGCTGTTGTAGAAGCTATTGTGTTTAAA
AAATACTCTAGAAGTAGAAGACAAATTTCTTATCTTTCTTAGATAACTATTGGGGAACAG
TAAGGTTTTATTATTTTGGAGTAAGAATAAATAGAATAAATTATTTCTGAAAATTTACTG
GCAAACCGAATTGAGGTTTATGAATATGAATTGAGCTAATCAATATTTTAAAAAGAACTA
AAAAAGTATTTAGCCACAAATGACTCATTAAATAATAATCAGCAAGGCTCAAATGAATAA
TAAAAGATAAACTAATAAGAACATGAGCTGAATGATTTTGAGCTTGAGAGTAATAAAGTT
AATGTATCTTTGTAAAGAGAATAATAAATTTTTAGTGATTTTGAAGGTGAAAATATATGT
GATGAGAAAAATATTTTGAATTAAGAAGAGATTTAACTCAGCGAAAATTTATAAGAGAAA
GATGCTGCAGAAAATTTAGGGTTTATTGAAGAAAACTATGCTTAAAAAGAATCTAACACA
AACAAAGACTAATAAGGTGATTAAGAGTAATTTAATGAATAATATATGCAGGCTGAAGAC
TTAGTTATAAATATTCAATCTCACTATTAAGAATAAGAGACTGAATAATTCCATGAATAA
TTGGAAGAATAATCGAAGCATGAATTAACTAACAAAGAATCTAATAATTTTATTGAAGAA
AATATCCTAAATGCAAATTTAGTATAAAAAGAAAATGAAAATTTGGAATCAACAAATGAA
AATAAGTGCTAAAATGAGTAAGAATAAAACCATTCACAATAAGATAATTAATAATAAATG
TAATTGTAATAAAATAATTATGAATAAAAGTAATTTCAATAAGATAATTAAGAATTGATA
AATAAGCAAGATTAGCTATGTCAAAATAATATAAATTACCACACTTAATTTTTAAAATAA
GATAATTATTAATTTCAACAGCAGCAATAGAATGGATAATAACAAAATTTGTAATATACA
ATTTAATAAATATTCAATCAAGAAAATGATAGTGATAGTTAATCTTCCTAGCATAATAAT
AAATCTCCTCAAATTGAAATTAATGCTTAAGAAGCTTAGCTTGATTAAAGCAAGAAACAA
AGTCATTAGAATTCAAGTATGAATCTGTCTTAAGGTAAAATGCACGGATAAAATAGTTAA
GGAAAAAATTAAAATTTTTAGTTAAGTCAGAGTATTTAATTAGTAAATTTAATAGATGAA
ACTTCTCAATAATAAGATAGAAAACTAGAATTTGACTCTAAAATTGAAGATGAATCGATT
CTATAGTAATAATAATAATAATAAAGCTAATCATAAGCTTTAAGCTAACAAAAAGAAGAA
AAGATCATTGAAAACTTTGAACTTAGTGAAGTAAAAAGCGAGGATGTGAATTTATTAATT
TAGAGTAAAGACAAATTTTTAGTTTCACAAGCTTAAGATACAAAAACAGAATTAGAAAGC
CAGTCATCAGAACTTCTTAATTTAATCAATTAAAAGGAAAAACTACAAAAAAATGCTTAA
ATTGATAAAAAATTTTCTGAAAAAATTTACTAAAAAAGGTAAGTCAGTCAAATAAAATAA
GATAATAAATAAAATAATTTAGACTTAAATAACAACAATAGACGTAATATTTAAAGCACG
AATGTAAAAAATTAGCAAAATTCAATCGTTTTAAAAAATGATCAAGAGATTTTTAAGATG
CCAACCAAAACACAAAAATCAAGATAATAAAATGAAAATCTATCTCAAAAACAAAAATAG
GCAAGTAAAAGCAATCTCTGTTTAATCGAAATTGATTCAGACGATTATATTTGTGTGGAT
AACAAAAATTATAAAGTACTTTAAAAGCCCAAAGAAGTAACGATACAGCCTTCAATTTCA
GAAATAGATTAATTTCATTCTTTAGAGAGCCATGATTTAATTAAAAAAAGTAAAGAACAA
ATAAAAATAACAAAATAAATTGGAGCTATGAAATATTTGGTTAATGAGTTGAGTAACAAA
AATTAATATGGGTAATTTTCTAAAGACAAGGCAGACATTATAATTAACCATAAACTAAAT
ATTCGTGAATAACACTAAGACGAAGTTTATACACAATTCAACATTACCAAATGCTTATAT
AAAGTTACATGGAAAAAAAGACCTTCTGGAAGAATTCCTCAACCCAGTTATTTCACTTTC
AACGAACTATATCAAGTGGCTCCAAGGTTACTTCTAGAATATCTAAAGAAAATGGCAACA
CTGAAAGTGTGA