Identifiers and Description

Gene Model Identifier

TTHERM_00079520

Standard Name

GTU1 (Gamma-TUbulin 1)

Aliases

PreTt10197 | 5.m00548 | 3828.m01461

Description

Gamma-tubulin; GTU1p is essential; localizes to microtubule-organizing centers in vegetative cells: basal bodies, macronuclear envelopes, micronuclear envelopes, and contractile vacuole

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00079520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_219790
Tetrahymena borealisEI9_06993.19.997093137033517e-262tubulin/FtsZ family, GTPase do
main-containing protein (450 a
a)
DictyBaseDDB_G02717389.997093137033517e-262tubC on chromosome: 2 position
727031 to 728611
OxytrichaContig3513.0.g109.997093137033517e-262Tubulin/FtsZ family, GTPase do
main
SGDYLR212C9.996050283847121e-108TUB4 Gamma-tubulin, involved i
n nucleating microtubules from
both the cytoplasmic and nucl
ear faces of the spindle pole
body
WormBaseWBGene000065404.001242549923285e-107locus:tbg-1 Tubulin gamma ch
ain status:Confirmed UniPr
ot:P34475 protein_id:CAA8016
4.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25660693: Kushida Y, Takaine M, Nakano K, Sugai T, Numata O (2015) Dynamic Change of Cellular Localization of Microtubule-Organizing Center During Conjugation of Ciliate Tetrahymena thermophila. Zoological science 32(1):25-32
  2. Ref:21246753: Kushida Y, Nakano K, Numata O (2011) Amitosis requires ?-tubulin-mediated microtubule assembly in Tetrahymena thermophila. Cytoskeleton (Hoboken, N.J.) 68(2):89-96
  3. Ref:11891286: Shang Y, Song X, Bowen J, Corstanje R, Gao Y, Gaertig J, Gorovsky MA (2002) A robust inducible-repressible promoter greatly facilitates gene knockouts, conditional expression, and overexpression of homologous and heterologous genes in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 99(6):3734-9
  4. Ref:12356864: Shang Y, Li B, Gorovsky MA (2002) Tetrahymena thermophila contains a conventional gamma-tubulin that is differentially required for the maintenance of different microtubule-organizing centers. The Journal of cell biology 158(7):1195-206
  5. Ref:8864661: Liang A, Ruiz F, Heckmann K, Klotz C, Tollon Y, Beisson J, Wright M (1996) Gamma-tubulin is permanently associated with basal bodies in ciliates. European journal of cell biology 70(4):331-8
  6. Ref:8124706: Stearns T, Kirschner M (1994) In vitro reconstitution of centrosome assembly and function: the central role of gamma-tubulin. Cell 76(4):623-37

Sequences

>TTHERM_00079520(coding)
ATGCCTAGAGATATAATTACACTTTAAGTCGGCCAATGCGGAAACTAAATTGGTATGGAA
TTTTGGAAATAGCTTTGTTTAGAGCATGGTATTAACCAAGAAGGTATTTTACAAGAATAT
GCAACAAACACTGATGACAGAAAAGAAGTTTTCTTTTATTAAGCAGATGATTAGCATTAT
ATTCCAAGGGCCTGTCTTATTGATTTAGAAGACAGAGTTCTAAAGAGAATAGTTAAATAA
TCTGATTATAGTTCACTATATAACCCAGAAAATATTTTTTATGGAACTGATGGATCAGGT
GCTGGTAATGTGTGGGCATACGGTTATTAAGAAGCTAATAAAATCCAAGATGATCTTCTT
GATATGATTGACAGAGAAGCTGATACATCTGATAGTTTTGAAGCTTTTCTTTTGATTCAT
AGTATTGCAGGTGGTACTGGTTCAGGTGTTGGCTCTTATTTATTGGAGAAATTAAATGAT
AGATTCCCTAAAAAAATTATTAAGACTTACTCTGTTTTTCCTAGTGGACACACAGATGGT
GTCGTACATCCTTATAACTCTCTTTTAACTTTAAAGAGACTTGCTTTGAATGCAGATGCA
ACCACTGTTTTAGATAATAACGCTTTAGAAAAAATAGCACAAGACAGATTAAAATTGGAA
AATCCTACAATTGAAACCACAAACTCACTTGTCTCAACAGTTATGGCAGCATGTACTACC
ACACTCAGATACCCTGGTTATATGAATAACGATTTAGTTGGTTTACTTGCATCTCTTGTT
CCTACACCTAAATGTCATTTCTTAATGACTGGATATACTCCTATCTCTATTGATAGACAT
ATAAAAACTATTAGAAAGACTACTGTACTTGATGTTATGAGAAGATTACTTTAAACAAAG
AATATCATGGTTAGTGCTTCAACTAAAAAGGGACAATATATTTCAATTATGAATGTAATT
CAAGGAGAAGTTGATGCATCTCAAATTCATAAATCACTTTAGCGTATTAGAGAAAGAAAA
TTAGCTAACTTTATTAACTGGGGACCTGCCTCCATACAAGTTGCATTATCTAAAAAATCA
CCATACATAGAAACATCTCATAAAGTAAGTGGTCTTATGCTCGCCAACCACACAAGCATC
CATACACTTTTTGAGAAGATTATCTCTAACTTTGACATAATGAGAAAAAAGAATGCTTAT
ATAGAATAGTTTAAAAAGGTTGATTCTTTTAACTTAGAGGAGTTCGATGATTCCAAGGAA
GTAGTACAATAATTAATAGAAGAATATAAAGCTGCTGAAGAACCTAACTATTTAGATTAC
TTCGATGATGGCTTGGAAGACGAAAACTGA


>TTHERM_00079520(protein)
MPRDIITLQVGQCGNQIGMEFWKQLCLEHGINQEGILQEYATNTDDRKEVFFYQADDQHY
IPRACLIDLEDRVLKRIVKQSDYSSLYNPENIFYGTDGSGAGNVWAYGYQEANKIQDDLL
DMIDREADTSDSFEAFLLIHSIAGGTGSGVGSYLLEKLNDRFPKKIIKTYSVFPSGHTDG
VVHPYNSLLTLKRLALNADATTVLDNNALEKIAQDRLKLENPTIETTNSLVSTVMAACTT
TLRYPGYMNNDLVGLLASLVPTPKCHFLMTGYTPISIDRHIKTIRKTTVLDVMRRLLQTK
NIMVSASTKKGQYISIMNVIQGEVDASQIHKSLQRIRERKLANFINWGPASIQVALSKKS
PYIETSHKVSGLMLANHTSIHTLFEKIISNFDIMRKKNAYIEQFKKVDSFNLEEFDDSKE
VVQQLIEEYKAAEEPNYLDYFDDGLEDEN


>TTHERM_00079520(gene)
ATGCCTAGAGATATAATTACACTTTAAGTCGGCCAATGCGGAAACTAAAGTATTAGATTT
ATTTGAGATTAGAGTTTAAATAATGGAGATTTGCTTATTATTTTAGCACTTCATCAGCTT
TATAGGAATGGATGGATTTATAATTTAATTTTTTTAAAAATTCAAGTTGGTATGGAATTT
TGGAAATAGCTTTGTTTAGAGCATGGTATTAACCAAGAAGGTATTTTACAAGAATATGCA
ACAAACACTGATGACAGAAAAGAAGTTTTCTTTTATTAAGCAGATGATTAGCATTATATT
CCAAGGGCCTGTCTTATTGATTTAGAAGACAGAGTTCTAAAGAGAATAGTTAAATAATCT
GATTATAGTTCACTATATAACCCAGAAAATATTTTTTATGGAACTGATGGATCAGGTGCT
GGTAATGTGTGGGCATACGGTTATTAAGAAGCTAATAAAAGTAAATTTTAAAACTTATAA
ATTAAAAATTGTTATAAAATTACTAAAAATGTTGTGTTTTAGATAAGCAAAATTTTTAAA
ATTATATCAAAATTTATTGAAAGAATTAAGGAAATTCGATTTAAAGATTGAGATTAAATG
AAAGAATTGCATAGAAATATAATGGATTTTAATCTATAATTTACAAATAAAAATAATTGA
GCTTATCAAATTTTTAAAAAAATTATGTTCTCTCATTTATATGTGATGCTTTATTATAAT
TTAAAAAATATTAGTCCAAGATGATCTTCTTGATATGATTGACAGAGAAGCTGATACATC
TGATAGTTTTGAAGCTTTTCTTTTGATTCATAGTATTGCAGGTGGTACTGGTTCAGGTGT
TGGCTCTTATTTATTGGAGAAATTAAATGATAGATTCCCTAAAAAAATTATTAAGACTTA
CTCTGTTTTTCCTAGTGGACACACAGATGGTGTCGTACATCCTTATAACTCTCTTTTAAC
TTTAAAGAGACTTGCTTTGAATGCAGATGCAACCACTGTTTTAGATAATAACGCTTTAGA
AAAAATAGCACAAGACAGATTAAAATTGGAAAATCCTACAATTGAAACCACAAACTCACT
TGTCTCAACAGTTATGGCAGCATGTACTACCACACTCAGATACCCTGGTTATATGAATAA
CGATTTAGTTGGTTTACTTGCATCTCTTGTTCCTACACCTAAATGTCATTTCTTAATGAC
TGGATATACTCCTATCTCTATTGATAGACATATAAAAACTATTAGAAAGACTACTGTACT
TGATGTTATGAGAAGATTACTTTAAACAAAGAATATCATGGTTAGTGCTTCAACTAAAAA
GGGACAATATATTTCAATTATGAATGTAATTCAAGGAGAAGTTGATGCATCTCAAATTCA
TAAATCACTTTAGCGTATTAGAGAAAGAAAATTAGGTAAAATTTTAAATAAATAAAAATT
GAATGAATAAAAATATTTTAAAAAAAGCTAACTTTATTAACTGGGGACCTGCCTCCATAC
AAGTTGCATTATCTAAAAAATCACCATACATAGAAACATCTCATAAAGTAAGTGGTCTTA
TGCTCGCCAACCACACAAGCATCCATACAGTAATAATTATTATTATTATTCTAAAATTAA
AAAAATATTTTTTGCCTTATATTAAAAGCTTTTTGAGAAGATTATCTCTAACTTTGACAT
AATGAGAAAAAAGAATGCTTATATAGAATAGTTTAAAAAGGTTGATTCTTTTAACTTAGA
GGAGTTCGATGATTCCAAGTAAATAAACTCTAAAAATCATTTTTAATTAATATATTTATT
ACTAATTTAAATAGGGAAGTAGTACAATAATTAATAGAAGAATATAAAGCTGCTGAAGAA
CCTAACTATTTAGATTACTTCGATGATGGCTTGGAAGACGAAAACTGA