Identifiers and Description

Gene Model Identifier

TTHERM_00245180

Standard Name

GTP3 (GTPase)

Aliases

PreTt02414 | 21.m00381 | TGP5

Description

Similar to Rab2; putative intermediate compartment protein; putative involvement in regulated secretion

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00245180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00627.11.99972299831384e-147small GTP-binding protein doma
in-containing protein (208 aa)
OxytrichaContig9955.0.g639.996373193201036e-79Ras family
DictyBaseDDB_G02922682.999564368270328e-76rab2A on chromosome: 6 positio
n 1422661 to 1423817
WormBaseWBGene000068333.000298514542485e-73locus:unc-108 status:Confirm
ed UniProt:O01577 protein_
id:CCD66422.1
SGDYGL210W9.997652352281279e-57YPT32 Rab family GTPase, very
similar to Ypt31p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
Stentor CoeruleusSteCoe_280241.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00245180(coding)
ATGAGCTATTCATATTTGTTTAAATATATTATTATAGGAGATTCTAGTGTTGGAAAGTCT
GCCATTTTGCTTCAATTTATGGAGGGTAAATTTAAGGCTGAGCATGATACAACTATAGGA
GTTGAGTTTGGTTCTAAAATTATATAAGTTAAAGGGAAAAATGTCAAATTGTAAGTTTGG
GATACTGCTGGATAAGAGTCATTTAAGTCAATAACTAGATCATATTATAGAGGTTCAATT
TGTGCTTTCCTCGTTTATGATGTAACAAATCGTGAAAGCTTCACAAATATTTAAAAGTGG
TTAGAAGAGACTCAAAATTATGCAAATGATAAAATTACTCTAGTGTTAGTTGGTAACAAG
ATTGATCTTGCAAATAAAAGGCAAGTTTCTTATGACGAAGGACACGAATTTGCACAAAAA
TAAGAAATTCAATTTGTTGAAACTTCAGCTAAAATGGGATAAAATATTGATCAGGTTTTC
AGAAAAAGTACAGAAGATATCTTGTAAAAAATAGAAAATAGATAGGTAGATGCTACAAAT
GAATCTCTTGGAATAAAGATAGGACCATAATTAACAGAAAAAATGGTTTCAGATACAAAA
AAAACTAAAAAAGAATGTTGCTGA


>TTHERM_00245180(protein)
MSYSYLFKYIIIGDSSVGKSAILLQFMEGKFKAEHDTTIGVEFGSKIIQVKGKNVKLQVW
DTAGQESFKSITRSYYRGSICAFLVYDVTNRESFTNIQKWLEETQNYANDKITLVLVGNK
IDLANKRQVSYDEGHEFAQKQEIQFVETSAKMGQNIDQVFRKSTEDILQKIENRQVDATN
ESLGIKIGPQLTEKMVSDTKKTKKECC


>TTHERM_00245180(gene)
ATGAGCTATTCATATTTGTTTAAATATATTATTATAGGAGATTCTAGTATAAATATCATT
TTTTATCAAAAATTTGAGTTAACCAAATATTCTTTCATTATTTAATTCAGGTGTTGGAAA
GTCTGCCATTTTGCTTCAATTTATGGAGGGTAAATTTAAGGCTGAGCATGATACAACTAT
AGGAGTTGAGTTTGGTTCTAAAATTATATAAGTTAAAGGGAAAAATGTCAAATTGTAAGT
TTGGGATACTGTAAAACGATATTTTTATAAAAAATATTCAATATCGCTCATAAAGAATTA
TTTTTTTATTTGATAAATAAAGGCTGGATAAGAGTCATTTAAGTCAATAACTAGATCATA
TTATAGAGGTTCAATTTGTGCTTTCCTCGTTTATGATGTAACAAATCGTGAAAGCTTCAC
AAATATTTAAAAGTGGTTAGAAGAGACTCAAAATTATGCAAATGATAAAATTACTCTAGT
GTTAGTTGGTAACAAGATTGATCTTGCAAATAAAAGGCAAGTTTCTTATGACGAAGGACA
CGAATTTGCACAAAAATAAGAAATTCAATTTGTTGAAACTTCAGCTAAAATGGGATAAAA
TATTGATCAGGTAATGATTTAGCCCTTAAAAAATAATTTTAGAATATAAATAGTTCCTAA
GAAAATTTTTTCATTCATTCAACACAAGATTTTTTTACGTTATTGAACTCATTAGGATTA
CTTTATTTATATCAATATCCAAAGAACTTAGAATAAATAAAATGATTGATTGATATATTT
AATCGATATAAAGCCATTTATATTCTTAGCCGTCTAAAATTCAAAGGATGAATGCAAGAA
AAATAAAAATTAAAAAATAACTACTTGAAAATTTAAAATCAAATAAATTTTTTCTACTTT
TTCACATATTTTAATTTGAGTGTACTTTATCTGTTAAAATCTAATTCTATTAATTTTAAA
ATCTATTCCTTTTAATACAAAAATATATTTATTTTAACTATAAAATTTTGAATTAAAACA
GACAATAGAGTACTTCAAATTTTCTAAAATTATTTTTTAATAAATAAATAAATTTACTTT
TTATCTCAAAGTCAATCTTTTTAACTAATAATTCTAAACCAACTTATTAGATGGTAAATT
AGAAGTTGTAGTGATTAATTTAAAGCCTAAAAATGAATATTGATATCATTAATCTTTTAT
TAATTTATAGGTTTTCAGAAAAAGTACAGAAGATATCTTGTAAAAAATAGAAAATAGATA
GGTAGATGCTACAAATGAAGTAATATTTAGATCTCATAAATTAATTTACTTATAAGTTTT
ATTTTAAAATATTTATAGTCTCTTGGAATAAAGATAGGACCATAATTAACAGAAAAAATG
GTTTCAGATACAAAAAAAACTAAAAAAGAATGTTGCTGA