Identifiers and Description

Gene Model Identifier

TTHERM_00467790

Standard Name

GTP2 (GTPase)

Aliases

PreTt18681 | 55.m00236 | RAB2A | 3710.m00085

Description

Similar to Rab2; putative intermediate compartment protein; putative involvement in regulated secretion

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00467790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15714.13.001476460448119e-154Ras family protein (212 aa)
OxytrichaContig22591.0.g1122.000234809436283e-103Ras family
WormBaseWBGene000068332.9999146385131704e-95locus:unc-108 status:Confirm
ed UniProt:O01577 protein_
id:CCD66422.1
DictyBaseDDB_G02922686.997716170296885e-95rab2A on chromosome: 6 positio
n 1422661 to 1423817
SGDYER031C2.0008958828286524e-54YPT31 Rab family GTPase, very
similar to Ypt32p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
Stentor CoeruleusSteCoe_115687.47197233734299e-43

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00467790(coding)
ATGAGTTACGCCTATCTTTTTAAGTATATTATCATCGGTGATACTGGTGTCGGTAAAAGT
TGCATCCTCTCTCAATTCATAGATAAGAGATTCAAAGAAAAGCACGATGTAACTATCGGT
GTCGAGTTTGGTGCAAGAATGATTAGTTTTGATAATAAAAATATTAAGCTTTAGATTTGG
GATACAGCTGGTTAAGAATCCTTTAGATCAATTACTCGTTCATATTATAGATCAGCAGCT
GGAGCTCTTTTAGTTTACGATATTACTAAGCGTGAGAGTTTCTAACATCTTGGCAGATGG
CTTGAAGAAGCTAGATAAAACGGAAACCCATAAATGAGTTTTATTTTAGTTGGTAACAAG
TGCGATTTGGAATAAGATCGTCAAGTAAGCTATGAAGAAGGTGAAAAGTTTGCCAAAGAG
CATGATCTTGTTTATTTAGAAGTAAGTGCTAAAACCGCATATAATGTTGAAGAAGCCTTC
AAATAAACAGCAAAAATGATCTATGAAAAGATTAATCAAGGCTTAATAGATCCTAACATC
GAGACTTTTGGAGTAAAGGTTGGAACTGAATAAAATACTATGACTTTATCAGCAAAAACA
AAGCCAACACCTCCAGCATCTAATGGCTGTTGTTGA


>TTHERM_00467790(protein)
MSYAYLFKYIIIGDTGVGKSCILSQFIDKRFKEKHDVTIGVEFGARMISFDNKNIKLQIW
DTAGQESFRSITRSYYRSAAGALLVYDITKRESFQHLGRWLEEARQNGNPQMSFILVGNK
CDLEQDRQVSYEEGEKFAKEHDLVYLEVSAKTAYNVEEAFKQTAKMIYEKINQGLIDPNI
ETFGVKVGTEQNTMTLSAKTKPTPPASNGCC


>TTHERM_00467790(gene)
ATGAGTTACGCCTATCTTTTTAAGTATATTATCATCGGTGATACTGGTATGTTTAAAGAA
ATTATTTAATCTTGCCTTTATGACATTTTATTTTTATTAAAAAAGGTGTCGGTAAAAGTT
GCATCCTCTCTCAATTCATAGATAAGAGATTCAAAGAAAAGCACGATGTAACTATCGGTG
TCGAGTTTGGTGCAAGAATGATTAGTTTTGATAATAAAAATATTAAGCTTTAGATTTGGG
ATACAGTAATTAATTATATTTTACAAATAACACTTTACCTCCTCTTTGAAGGATCACTAA
ATAGTTATTTCTTAAGCTATAAAATAAAATAAATTGATTAGATTTTTGATTATTTTTTCA
AACATAAAAATAATTTAAAATACTTTAAAACAATTAGGCTGGTTAAGAATCCTTTAGATC
AATTACTCGTTCATATTATAGATCAGCAGCTGGAGCTCTTTTAGTTTACGATATTACTAA
GTAAAACAATTTTATCAATGTATTGACTAAATTTAAGTTAATTTTTTGTTGAAAAGGCGT
GAGAGTTTCTAACATCTTGGCAGATGGCTTGAAGAAGCTAGATAAAACGGAAACCCATAA
ATGAGTTTTATTTTAGTTGGTAACAAGTGCGATTTGGAATAAGAGTAAATTTTTATTGTT
AGATTGCTTTTAAAATTTTTACAATTTACTTTATCTGTGAAGCAAATTAAAAAATGTGTG
TGAGATGATTTCAATACACTTTGATTATAACTTTTATGAAGAAGAGAAAGATTTAAATAA
CATTTATAATTTTATAAATAGTCGTCAAGTAAGCTATGAAGAAGGTGAAAAGTTTGCCAA
AGAGCATGATCTTGTTTATTTAGAAGTAAGTGCTAAAACCGCATATAATGTTGAAGAAGC
CTTCAAATAAACAGCAAAAATGATCTATGAAAAGATTAATCAAGGCTTAATAGATCCTAA
CATCGAGGTAATATTAAATTTATTTTTTACTATTAAAATAACTAAAAGTTTCCTATTTAA
AATTAATATAAATAGACTTTTGGAGTAAAGGTTGGAACTGAATAAAATACTATGACTTTA
TCAGCAAAAACAAAGCCAACACCTCCAGCATCTAATGGCTGTTGTTGA