Identifiers and Description

Gene Model Identifier

TTHERM_00405500

Standard Name

GST7 (Glutathione S-transferase mu 7, TtGSTm7, GSTm7)

Aliases

PreTt12797 | 43.m00315 | 3713.m00137

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00405500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04321.11.000434858898539e-105glutathione S-transferase doma
in-containing protein (209 aa)
OxytrichaContig16299.0.g157.997402223525235e-19Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02681380.0000007001298633766835DDB_G0268138 on chromosome: 1
position 1528262 to 1528973
Stentor CoeruleusSteCoe_298040.0000022603294069810542
WormBaseWBGene000017850.00020003864201578029locus:gst-37 status:Partiall
y_confirmed UniProt:Q9BPM4
protein_id:CCD74297.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00405500(coding)
ATGTCTTCATAAACTATAAACTTAGGATACTGGGGTTTTCCATTAAGAGCATAACCTATA
AGATATATTTTTGAACTTGCTCAATATCCATACTAATAGACTAACTATACTTTTGAAGGA
GCTAAAGACTGGTTTGAAAAAGATAAAAAAGACCTTGGTCTAGATTTTCCTAACTTGCCT
TACCTTATACATGGCGATTTTAAGATCACTGAGTCTTAAAACATTATCAATTACGCTTTG
GACGTCACTAAGTAGCATCATTTATTGGGATATGGACTAACAAAATTTAAGATAGATAAC
GTCAGATTCCTTTGTGATGAGTTGATTGCCAAAACATTCTTAGCATCAACAAAAACAGGA
GAAGAAAAGAAGGCTGAAATCAACAGCTCTGTTACTCCTAAATTTAAGAGTTTATAAGCT
GTTTTAGGAAACAAAAAGTTTTTCTTTGAAGACAAGTTAACTCTTGCTGATATTTATGCT
TACACAGCAATAAATGCACTGAAGCATTTGTTGAATGATGAATACAAGTAATTTGCTTAA
ACTTTTGATCCATTTATGAAAAACTTTGAAGAAGTTCCTTTAATTAAGGCTTATCATAGC
TCAAACAGATATCCTAAATTTGCATGA


>TTHERM_00405500(protein)
MSSQTINLGYWGFPLRAQPIRYIFELAQYPYQQTNYTFEGAKDWFEKDKKDLGLDFPNLP
YLIHGDFKITESQNIINYALDVTKQHHLLGYGLTKFKIDNVRFLCDELIAKTFLASTKTG
EEKKAEINSSVTPKFKSLQAVLGNKKFFFEDKLTLADIYAYTAINALKHLLNDEYKQFAQ
TFDPFMKNFEEVPLIKAYHSSNRYPKFA


>TTHERM_00405500(gene)
ATGTCTTCATAAACTATAAACTTAGGATACTGGGGTTTTCCATTAAGAGCATAACCTATA
AGATATATTTTTGAACTTGCTCAATATCCATACTAATAGACTAACTATACTTTTGAAGGA
GCTAAAGACTGGTTTGAAAAAGATAAAAAAGACCTTGGTCTAGATTTTCCTAACTTGCCT
TACCTTATACATGGCGATTTTAAGATCACTGAGTCTTAAAACATTATCAATTACGCTTTG
GACGTCACTAAGTAGCATCATTTATTGGGATATGGACTAACAAAATTTAAGATAGATAAC
GTCAGATTCCTTTGTGATGAGTTGATTGCCAAAACATTCTTAGCATCAACAAAAACAGGA
GAAGAAAAGAAGGCTGAAATCAACAGCTCTGTTACTCCTAAATTTAAGAGTTTATAAGCT
GTTTTAGGAAACAAAAAGTTTTTCTTTGAAGACAAGTTAACTCTTGCTGATATTTATGCT
TACACAGCAATAAATGCACTGAAGCATTTGTTGAATGATGAATACAAGTAATTTGCTTAA
ACTTTTGATCCATTTATGAAAAACTTTGAAGAAGTTCCTTTAATTAAGGCTTATCATAGC
TCAAACAGATATCCTAAATTTGCATGA