Identifiers and Description

Gene Model Identifier

TTHERM_00575360

Standard Name

GST62 (Glutathione S-transferase zeta 1, TtGSTz1, GSTz1)

Aliases

PreTt28926 | 77.m00138 | 3812.m02621

Description

maleylacetoacetate isomerase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00575360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04003.11.99972299831384e-147maleylacetoacetate isomerase (
221 aa)
DictyBaseDDB_G02781554.000904604388404e-59mai on chromosome: 3 position
376116 to 376878
WormBaseWBGene000017905.001636743996964e-56locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
OxytrichaContig3598.0.1.g928.002420766648515e-44Glutathione S-transferase, C-t
erminal domain
Stentor CoeruleusSteCoe_202244.780892883885469e-25
SGDYNL229C0.0000009995106777214876URE2 Nitrogen catabolite repre
ssion transcriptional regulato
r that acts by inhibition of G
LN3 transcription in good nitr
ogen source; has glutathione p
eroxidase activity and can mut
ate to acquire GST activity; a
ltered form creates [URE3] pri
on

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575360(coding)
ATGGCTGAAAGCTCAAAGAAAATTACTCTTTACAGTTATTTCCGCTCCTCAACTTCATGG
AGAGTAAGAATAGCTCTTAATCTTAAGAAAATAGACTACAACATCATTCCTATTAACCTT
TTGAAGAGTGAATAAACTTCTGAAGAATATACTAAAATCAATCCTAACTAGGGAGTCCCT
GCTTTAAAGTATGGAGACGAGGTTATTATTGAAAGCTCTGCTATCTTAGAGTTTTTGGAA
GAAGTATTTCCTGAGCACCCACTTCTTCCTTAAGATGCAGTTAAAAGAGCTTAAATTAGA
GGCTTTTGCCAAGTAATTAACACTGCCATCCACCCTCTCTAAAATTTGAGGGTGCTTAAT
AAGATTGAAAAGGAATATAGCTAAGACAAGATTCAATGGCTCAAATTCTGGGTTACTAAG
GGTTTGACAGCAATTGAAGAATTATTAAAGAATTCTCATGGAAAATATTGCTTTGGTGAT
GAAATAACACTTGCTGACTTATTCTTGGTACCTCAAGTTCAAGGAGTTGTAGATAGATTC
CAATTTGATTTAACCCCTTTCCCCAATATTGCAGAAGTTTTAAAAAATTTAAAGGAAATT
CCTGAGTTCGTTGCTGCCTCACCCAGCAAGTAAGCTGACAATCCTGATAATCAAAAGATC
TGA


>TTHERM_00575360(protein)
MAESSKKITLYSYFRSSTSWRVRIALNLKKIDYNIIPINLLKSEQTSEEYTKINPNQGVP
ALKYGDEVIIESSAILEFLEEVFPEHPLLPQDAVKRAQIRGFCQVINTAIHPLQNLRVLN
KIEKEYSQDKIQWLKFWVTKGLTAIEELLKNSHGKYCFGDEITLADLFLVPQVQGVVDRF
QFDLTPFPNIAEVLKNLKEIPEFVAASPSKQADNPDNQKI


>TTHERM_00575360(gene)
ATGGCTGAAAGCTCAAAGAAAATTACTCTTTACAGTTATTTCCGCTCCTCAACTTCATGG
AGAGTAAGAATAGCTCTTAATCTTAAGAAAATAGACTACAACATCATTCCTATTAACCTT
TTGAAGAGTGAATAAACTTCTGAAGAATATACTAAAATCAATCCTAACTAGGTAATTAAT
TTAATTTTTTATGAGAGTAATTATAATTCTAAGAAATATAAAACACTATTAGGGAGTCCC
TGCTTTAAAGTATGGAGACGAGGTTATTATTGAAAGCTCTGCTATCTTAGAGTTTTTGGA
AGAAGTATTTCCTGAGCACCCACTTCTTCCTTAAGATGCAGTTAAAAGAGCTTAAATTAG
AGGCTTTTGCCAAGTAATTAACACTGCCATCCACCCTCTCTAAAATTTGAGGGTGCTTAA
TAAGATTGAAAAGGAATATAGCTAAGACAAGATTCAATGGCTCAAATTCTGGGTTACTAA
GGGTTTGACAGGTAATTAATTTTAATTCTATTATAATGAATGAGCGTTCAATAATTTAAA
AAATATATAAAGCAATTGAAGAATTATTAAAGAATTCTCATGGAAAATATTGCTTTGGTG
ATGAAATAACACTTGCTGACTTATTCTTGGTACCTCAAGTTCAAGGAGTTGTAGATAGAT
TCCAATTTGATTTAACCCCTTTCCCCAATATTGCAGAAGTTTTAAAAAATTTAAAGGAAA
TTCCTGAGTTCGTTGCTGCCTCACCCAGCAAGTAAGCTGACAATCCTGATAATCAAAAGA
TCTGA