Identifiers and Description

Gene Model Identifier

TTHERM_00034950

Standard Name

GST60 (Glutathione S-transferase omega 6, TtGSTo6, GSTo6)

Aliases

PreTt14330 | 2.m02344 | 3825.m02712

Description

GST60 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_00034950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00889.12.0002124324463154e-144glutathione S-transferase doma
in-containing protein (262 aa)
WormBaseWBGene000017910.0000000010002658722841845locus:gst-43 status:Confirme
d UniProt:Q9N4H6 protein_i
d:CCD73500.1
OxytrichaContig19947.0.g220.00000030014504373857585Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02781550.0000004998288985444982mai on chromosome: 3 position
376116 to 376878

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00034950(coding)
ATGAAAAAACCTATTTTATATGGTTGCATAGTATGCCCTTATACAAACAAAGTAAGATTT
GCTTTAGAAATGCTTAAAATTGACTATAAATATCAAGAAATTGACATTCTTACTGGAAAA
AATAAAAATAATTCTTATCTATAAATTAATCCTTAAGGTAGAGTTCCTTCATTAACTACG
ATTAATAACAAAAATTTATATGACAGCTAAGTGCTCTTATAGTACATAGAGGATGAATAT
AAAGGTTTGTTTCCTTAAGATAACTATGCTAAAGGTCTCCAAAGAATATGGGTTTAGTAC
TTTGATAATAACATATTTTCAAAATATCATCCTGCACTAGCTGCATATTAAGAAAATAAA
TAAGACTTATTAAATAAGCTATAATAAGAAACATTTGAAAATATGAAATTCTTTTCATAG
AATTCTGGAATCACATAAAAAATAAAATTAAAATAAAACTGTTTTTATGAAGGAGGAAGC
ATTCCTACATATGCAGATGTAGCAATAATTCCTCATTTAAGAATTATGAATATATTTTGG
AAGCACTTTTTAAACAAAGATTTATTCTAATCAAATAAAAATGATGAAGATGTATTATCC
TTAAAGCAATTATATGAAAATATACATACATTGGAAAGTTGTTAAAATGTTTCTTTTTAA
TTTAAATAAATACCAACAAAAGGAGATAACCAATTAGTTGATGATTTAATCAATAAAAAC
TCTTTCAATTTTGAAAATTATATTGTAAATTTTTTAAAAATTAAATTAAGTTAAAAGTGA


>TTHERM_00034950(protein)
MKKPILYGCIVCPYTNKVRFALEMLKIDYKYQEIDILTGKNKNNSYLQINPQGRVPSLTT
INNKNLYDSQVLLQYIEDEYKGLFPQDNYAKGLQRIWVQYFDNNIFSKYHPALAAYQENK
QDLLNKLQQETFENMKFFSQNSGITQKIKLKQNCFYEGGSIPTYADVAIIPHLRIMNIFW
KHFLNKDLFQSNKNDEDVLSLKQLYENIHTLESCQNVSFQFKQIPTKGDNQLVDDLINKN
SFNFENYIVNFLKIKLSQK


>TTHERM_00034950(gene)
ATGAAAAAACCTATTTTATATGGTTGCATAGTATGCCCTTATACAAACAAAGTAAGATTT
GCTTTAGAAATGCTTAAAATTGACTATAAATATCAAGAAATTGACATTCTTACTGGAAAA
AATAAAAATAATTCTTATCTATAAATTAATCCTTAAGGTAGAGTTCCTTCATTAACTACG
ATTAATAACAAAAATTTATATGACAGCTAAGTGCTCTTATAGTACATAGAGGATGAATAT
AAAGGTTTGTTTCCTTAAGATAACTATGCTAAAGGTCTCCAAAGAATATGGGTTTAGTAC
TTTGATAATAACATATTTTCAAAATATCATCCTGCACTAGCTGCATATTAAGAAAATAAA
TAAGACTTATTAAATAAGCTATAATAAGAAACATTTGAAAATATGAAATTCTTTTCATAG
AATTCTGGAATCACATAAAAAATAAAATTAAAATAAAACTGTTTTTATGAAGGAGGAAGC
ATTCCTACATATGCAGATGTAGCAATAATTCCTCATTTAAGAATTATGAATATATTTTGG
AAGCACTTTTTAAACAAAGATTTATTCTAATCAAATAAAAATGATGAAGATGTATTATCC
TTAAAGCAATTATATGAAAATATACATACATTGGAAAGTTGTTAAAATGTTTCTTTTTAA
TTTAAATAAATACCAACAAAAGGAGATAACCAATTAGTTGATGATTTAATCAATAAAAAC
TCTTTCAATTTTGAAAATTATATTGTAAATTTTTTAAAAATTAAATTAAGTTAAAAGTGA