Identifiers and Description

Gene Model Identifier

TTHERM_00034950

Standard Name

GST60 (Glutathione S-transferase omega 6, TtGSTo6, GSTo6)

Aliases

PreTt14330 | 2.m02344 | 3825.m02712

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_00034950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00889.12.0002124324463154e-144glutathione S-transferase doma
in-containing protein (262 aa)
WormBaseWBGene000017910.0000000010002658722841845locus:gst-43 status:Confirme
d UniProt:Q9N4H6 protein_i
d:CCD73500.1
OxytrichaContig19947.0.g220.00000030014504373857585Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02781550.0000004998288985444982mai on chromosome: 3 position
376116 to 376878

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00034950(coding)
ATGAAAAAACCTATTTTATATGGTTGCATAGTATGCCCTTATACAAACAAAGTAAGATTT
GCTTTAGAAATGCTTAAAATTGACTATAAATATCAAGAAATTGACATTCTTACTGGAAAA
AATAAAAATAATTCTTATCTATAAATTAATCCTTAAGGTAGAGTTCCTTCATTAACTACG
ATTAATAACAAAAATTTATATGACAGCTAAGTGCTCTTATAGTACATAGAGGATGAATAT
AAAGGTTTGTTTCCTTAAGATAACTATGCTAAAGGTCTCCAAAGAATATGGGTTTAGTAC
TTTGATAATAACATATTTTCAAAATATCATCCTGCACTAGCTGCATATTAAGAAAATAAA
TAAGACTTATTAAATAAGCTATAATAAGAAACATTTGAAAATATGAAATTCTTTTCATAG
AATTCTGGAATCACATAAAAAATAAAATTAAAATAAAACTGTTTTTATGAAGGAGGAAGC
ATTCCTACATATGCAGATGTAGCAATAATTCCTCATTTAAGAATTATGAATATATTTTGG
AAGCACTTTTTAAACAAAGATTTATTCTAATCAAATAAAAATGATGAAGATGTATTATCC
TTAAAGCAATTATATGAAAATATACATACATTGGAAAGTTGTTAAAATGTTTCTTTTTAA
TTTAAATAAATACCAACAAAAGGAGATAACCAATTAGTTGATGATTTAATCAATAAAAAC
TCTTTCAATTTTGAAAATTATATTGTAAATTTTTTAAAAATTAAATTAAGTTAAAAGTGA


>TTHERM_00034950(protein)
MKKPILYGCIVCPYTNKVRFALEMLKIDYKYQEIDILTGKNKNNSYLQINPQGRVPSLTT
INNKNLYDSQVLLQYIEDEYKGLFPQDNYAKGLQRIWVQYFDNNIFSKYHPALAAYQENK
QDLLNKLQQETFENMKFFSQNSGITQKIKLKQNCFYEGGSIPTYADVAIIPHLRIMNIFW
KHFLNKDLFQSNKNDEDVLSLKQLYENIHTLESCQNVSFQFKQIPTKGDNQLVDDLINKN
SFNFENYIVNFLKIKLSQK


>TTHERM_00034950(gene)
ATGAAAAAACCTATTTTATATGGTTGCATAGTATGCCCTTATACAAACAAAGTAAGATTT
GCTTTAGAAATGCTTAAAATTGACTATAAATATCAAGAAATTGACATTCTTACTGGAAAA
AATAAAAATAATTCTTATCTATAAATTAATCCTTAAGGTAGAGTTCCTTCATTAACTACG
ATTAATAACAAAAATTTATATGACAGCTAAGTGCTCTTATAGTACATAGAGGATGAATAT
AAAGGTTTGTTTCCTTAAGATAACTATGCTAAAGGTCTCCAAAGAATATGGGTTTAGTAC
TTTGATAATAACATATTTTCAAAATATCATCCTGCACTAGCTGCATATTAAGAAAATAAA
TAAGACTTATTAAATAAGCTATAATAAGAAACATTTGAAAATATGAAATTCTTTTCATAG
AATTCTGGAATCACATAAAAAATAAAATTAAAATAAAACTGTTTTTATGAAGGAGGAAGC
ATTCCTACATATGCAGATGTAGCAATAATTCCTCATTTAAGAATTATGAATATATTTTGG
AAGCACTTTTTAAACAAAGATTTATTCTAATCAAATAAAAATGATGAAGATGTATTATCC
TTAAAGCAATTATATGAAAATATACATACATTGGAAAGTTGTTAAAATGTTTCTTTTTAA
TTTAAATAAATACCAACAAAAGGAGATAACCAATTAGTTGATGATTTAATCAATAAAAAC
TCTTTCAATTTTGAAAATTATATTGTAAATTTTTTAAAAATTAAATTAAGTTAAAAGTGA