Identifiers and Description

Gene Model Identifier

TTHERM_00630260

Standard Name

GST6 (Glutathione S-transferase mu 6, TtGSTm6, GSTm6)

Aliases

PreTt06541 | 89.m00135 | 3831.m01435

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00630260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04320.13.99907102031635e-130glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig16299.0.g152.99851380290819e-19Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017850.000030009396760408108locus:gst-37 status:Partiall
y_confirmed UniProt:Q9BPM4
protein_id:CCD74297.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00630260(coding)
ATGATAAAGTTAAAAAAATATAATCAATCAATAAATAAAACAAATAAATTAATAAACAAG
AAGCACTAAAAAAGCAAAAAAAACAAAAACAAGAAAATATTTTAAATGGGTTGTTAAAAT
TCTACAGGTTAAGTTAGCACTAACGAAATAAAGCAAGTTGAAAAGGTAGTTTTAGGTTAT
TGGGCTTTCCCTTTGAGAGGTTAGCCAATTAGATACATCTTAGAGCTTGCAAACTACCCT
TACACAGAAACTAAATACACTCCTTCTACTGCAACTGAATGGTTCGGAAAAGATAAACTA
GAGCTTGGATTAGACTTCCCTAATCTTCCCTACTTGATCCACGGAGACTTTTCAATTACA
GAGTCTTAAAATATTGTGAATTATTTGATATAATTAACAAACCAATAAAGTCTTTAAGGA
GAAGGCGAATTAAAATATAAAGTAGATAATATAAGATATGTATGCGATGATTTAATTTCC
AAGATATTCTTATCAACTAGAAAAAATGATGAAGAAAAGAAAACTGATCTTAATACTTAA
ATTATTCCAAAAATCAAATAGTTACAAAAGGTTTTAGGCAACAAAAACTCCTTCTTCAAC
AAGTTAACTTTAGCTGACATCTTCGGTTATACAGCTATTAATAACTTCAAAAAGACCTAT
CCTTAAGAATATGAAGAATTCGCTTCTACTTTTGATCCCTTGCTAAAAAGATTCGAAGAA
ATTCCCATCATTAAAAAATATCATTAATCTGATAGATACTTCAAATGA


>TTHERM_00630260(protein)
MIKLKKYNQSINKTNKLINKKHQKSKKNKNKKIFQMGCQNSTGQVSTNEIKQVEKVVLGY
WAFPLRGQPIRYILELANYPYTETKYTPSTATEWFGKDKLELGLDFPNLPYLIHGDFSIT
ESQNIVNYLIQLTNQQSLQGEGELKYKVDNIRYVCDDLISKIFLSTRKNDEEKKTDLNTQ
IIPKIKQLQKVLGNKNSFFNKLTLADIFGYTAINNFKKTYPQEYEEFASTFDPLLKRFEE
IPIIKKYHQSDRYFK


>TTHERM_00630260(gene)
ATGATAAAGTTAAAAAAATATAATCAATCAATAAATAAAACAAATAAATTAATAAACAAG
AAGCACTAAAAAAGCAAAAAAAACAAAAACAAGAAAATATTTTAAATGGGTTGTTAAAAT
TCTACAGGTTAAGTTAGCACTAACGAAATAAAGCAAGTTGAAAAGGTAGTTTTAGGTTAT
TGGGCTTTCCCTTTGAGAGGTTAGCCAATTAGATACATCTTAGAGCTTGCAAACTACCCT
TACACAGAAACTAAATACACTCCTTCTACTGCAACTGAATGGTTCGGAAAAGATAAACTA
GAGCTTGGATTAGACTTCCCTAATCTTCCCTACTTGATCCACGGAGACTTTTCAATTACA
GAGTCTTAAAATATTGTGAATTATTTGATATAATTAACAAACCAATAAAGTCTTTAAGGA
GAAGGCGAATTAAAATATAAAGTAGATAATATAAGATATGTATGCGATGATTTAATTTCC
AAGATATTCTTATCAACTAGAAAAAATGATGAAGAAAAGAAAACTGATCTTAATACTTAA
ATTATTCCAAAAATCAAATAGTTACAAAAGGTTTTAGGCAACAAAAACTCCTTCTTCAAC
AAGTTAACTTTAGCTGACATCTTCGGTTATACAGCTATTAATAACTTCAAAAAGACCTAT
CCTTAAGAATATGAAGAATTCGCTTCTACTTTTGATCCCTTGCTAAAAAGATTCGAAGAA
ATTCCCATCATTAAAAAATATCATTAATCTGATAGATACTTCAAATGA