Identifiers and Description

Gene Model Identifier

TTHERM_00630260

Standard Name

GST6 (Glutathione S-transferase mu 6, TtGSTm6, GSTm6)

Aliases

PreTt06541 | 89.m00135 | 3831.m01435

Description

GST6 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00630260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04320.13.99907102031635e-130glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig16299.0.g152.99851380290819e-19Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017850.000030009396760408108locus:gst-37 status:Partiall
y_confirmed UniProt:Q9BPM4
protein_id:CCD74297.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00630260(coding)
ATGATAAAGTTAAAAAAATATAATCAATCAATAAATAAAACAAATAAATTAATAAACAAG
AAGCACTAAAAAAGCAAAAAAAACAAAAACAAGAAAATATTTTAAATGGGTTGTTAAAAT
TCTACAGGTTAAGTTAGCACTAACGAAATAAAGCAAGTTGAAAAGGTAGTTTTAGGTTAT
TGGGCTTTCCCTTTGAGAGGTTAGCCAATTAGATACATCTTAGAGCTTGCAAACTACCCT
TACACAGAAACTAAATACACTCCTTCTACTGCAACTGAATGGTTCGGAAAAGATAAACTA
GAGCTTGGATTAGACTTCCCTAATCTTCCCTACTTGATCCACGGAGACTTTTCAATTACA
GAGTCTTAAAATATTGTGAATTATTTGATATAATTAACAAACCAATAAAGTCTTTAAGGA
GAAGGCGAATTAAAATATAAAGTAGATAATATAAGATATGTATGCGATGATTTAATTTCC
AAGATATTCTTATCAACTAGAAAAAATGATGAAGAAAAGAAAACTGATCTTAATACTTAA
ATTATTCCAAAAATCAAATAGTTACAAAAGGTTTTAGGCAACAAAAACTCCTTCTTCAAC
AAGTTAACTTTAGCTGACATCTTCGGTTATACAGCTATTAATAACTTCAAAAAGACCTAT
CCTTAAGAATATGAAGAATTCGCTTCTACTTTTGATCCCTTGCTAAAAAGATTCGAAGAA
ATTCCCATCATTAAAAAATATCATTAATCTGATAGATACTTCAAATGA


>TTHERM_00630260(protein)
MIKLKKYNQSINKTNKLINKKHQKSKKNKNKKIFQMGCQNSTGQVSTNEIKQVEKVVLGY
WAFPLRGQPIRYILELANYPYTETKYTPSTATEWFGKDKLELGLDFPNLPYLIHGDFSIT
ESQNIVNYLIQLTNQQSLQGEGELKYKVDNIRYVCDDLISKIFLSTRKNDEEKKTDLNTQ
IIPKIKQLQKVLGNKNSFFNKLTLADIFGYTAINNFKKTYPQEYEEFASTFDPLLKRFEE
IPIIKKYHQSDRYFK


>TTHERM_00630260(gene)
ATGATAAAGTTAAAAAAATATAATCAATCAATAAATAAAACAAATAAATTAATAAACAAG
AAGCACTAAAAAAGCAAAAAAAACAAAAACAAGAAAATATTTTAAATGGGTTGTTAAAAT
TCTACAGGTTAAGTTAGCACTAACGAAATAAAGCAAGTTGAAAAGGTAGTTTTAGGTTAT
TGGGCTTTCCCTTTGAGAGGTTAGCCAATTAGATACATCTTAGAGCTTGCAAACTACCCT
TACACAGAAACTAAATACACTCCTTCTACTGCAACTGAATGGTTCGGAAAAGATAAACTA
GAGCTTGGATTAGACTTCCCTAATCTTCCCTACTTGATCCACGGAGACTTTTCAATTACA
GAGTCTTAAAATATTGTGAATTATTTGATATAATTAACAAACCAATAAAGTCTTTAAGGA
GAAGGCGAATTAAAATATAAAGTAGATAATATAAGATATGTATGCGATGATTTAATTTCC
AAGATATTCTTATCAACTAGAAAAAATGATGAAGAAAAGAAAACTGATCTTAATACTTAA
ATTATTCCAAAAATCAAATAGTTACAAAAGGTTTTAGGCAACAAAAACTCCTTCTTCAAC
AAGTTAACTTTAGCTGACATCTTCGGTTATACAGCTATTAATAACTTCAAAAAGACCTAT
CCTTAAGAATATGAAGAATTCGCTTCTACTTTTGATCCCTTGCTAAAAAGATTCGAAGAA
ATTCCCATCATTAAAAAATATCATTAATCTGATAGATACTTCAAATGA