Identifiers and Description

Gene Model Identifier

TTHERM_00630450

Standard Name

GST59 (Glutathione S-transferase omega 5, TtGSTo5, GSTo5)

Aliases

PreTt06558 | 89.m00152 | 3831.m01453

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00630450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04339.17.002255246328404e-132glutathione S-transferase doma
in-containing protein (259 aa)
DictyBaseDDB_G02781550.000000000000006999063783600386mai on chromosome: 3 position
376116 to 376878
WormBaseWBGene000196360.0000000000005000841553255702locus:gsto-3 status:Partiall
y_confirmed UniProt:O17234
protein_id:CCD72880.1
OxytrichaContig19947.0.g220.000000030002053728821195Glutathione S-transferase, N-t
erminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00630450(coding)
ATGTCCAAATTAATCTTCTACGGTTACTTAATTTGCCCTTTTGCCTAAAGAGTCAGATTC
GCTTTAGAGGCTTTGAAGATAGATTATGAATTCGTTCATATTGATTTGCACGCTGGAGCT
TAAAAAGAAGAAGCCTATCTCAAAATAAATCCTTTTGGAAAACTACCTTCAATTCAAATC
GATGGAAAGGTTGTTTATGAAAGCTTGATACTTTTAGAATTTTTGGGAGATCATTTTGGT
GGTGTCTTCCCCAAAGACGATTTTGCCAAAGCTGAGAGTAGAATTTGGGCTAACTACTTT
GACTAAAATGTTGCAAGCAAAGTTTTTCCTCTGTTTGGCTTAAAGAAAGCTAATAATTAA
GAAGGAATCGAGAAACAAGCTCAAGAAATTTTAAATAACATCAAATTCTTTACATAAAAA
TCAGGCCTTGAAGATAGAATTAAGAATAATCCATAGAGCTACTTCAACGGCAATTAGTTG
AGCTTTGTCGATTTTGTTGTAGCTCCTCACATTAGAAATATTGAAACATTTTTTAAACTT
TTTGTAGGTAGAAGTATTTACAGTTTTGCTGAGCCCAATGAATCAATTTAAAACTTTGAA
AAGTACTCTAAAAACATACTTTAAAGCTAGCCTTATCTTTCAATTACAGACAAATTGAAA
TAATTACCTCCTATTGAAACTAACTCTTTCTTAAAAGAAATTGGAGTTGACTCTATTGAA
AAGTTTAATTACGAACATTTCTTTAAAGAGTTCCATCAAAAAAAATTCTTATCTTGA


>TTHERM_00630450(protein)
MSKLIFYGYLICPFAQRVRFALEALKIDYEFVHIDLHAGAQKEEAYLKINPFGKLPSIQI
DGKVVYESLILLEFLGDHFGGVFPKDDFAKAESRIWANYFDQNVASKVFPLFGLKKANNQ
EGIEKQAQEILNNIKFFTQKSGLEDRIKNNPQSYFNGNQLSFVDFVVAPHIRNIETFFKL
FVGRSIYSFAEPNESIQNFEKYSKNILQSQPYLSITDKLKQLPPIETNSFLKEIGVDSIE
KFNYEHFFKEFHQKKFLS


>TTHERM_00630450(gene)
ATGTCCAAATTAATCTTCTACGGTTACTTAATTTGCCCTTTTGCCTAAAGAGTCAGATTC
GCTTTAGAGGCTTTGAAGATAGATTATGAATTCGTTCATATTGATTTGCACGCTGGAGCT
TAAAAAGAAGAAGCCTATCTCAAAATAAATCCTTTTGGAAAACTACCTTCAATTCAAATC
GATGGAAAGGTATGCTTGTTATTTATTTATTTATTTTTTAACTTTTTAATTTGAAAAACT
TATTTTAATACATCTTAAATGATTATTTTAATATTAATCACATATAATTAATTAATTATA
AATAGGTTGTTTATGAAAGCTTGATACTTTTAGAATTTTTGGGAGATCATTTTGGTGGTG
TCTTCCCCAAAGACGATTTTGCCAAAGCTGAGAGTAGAATTTGGGCTAACTACTTTGACT
AAAATGTTGCAAGCAAAGTTTTTCCTCTGTTTGGCTTAAAGAAAGCTAATAATTAAGAAG
GAATCGAGAAACAAGCTCAAGAAATTTTAAATAACATCAAATTCTTTACATAAAAATCAG
GCCTTGAAGATAGAATTAAGAATAATCCATAGAGCTACTTCAACGGCAATTAGTTGAGCT
TTGTCGATTTTGTTGTAGCTCCTCACATTAGAAATATTGAAACATTTTTTAAACTTTTTG
TAGGTAGAAGTATTTACAGTTTTGCTGAGCCCAATGAATCAATTTAAAACTTTGAAAAGT
ACTCTAAAAACATACTTTAAAGCTAGCCTTATCTTTCAATTACAGACAAATTGAAATAAT
TACCTCCTATTGAAACTAACTCTTTCTTAAAAGAAATTGGAGTTGACTCTATTGAAAAGT
TTAATTACGAACATTTCTTTAAAGAGTTCCATCAAAAAAAATTCTTATCTTGA