Identifiers and Description

Gene Model Identifier

TTHERM_00572020

Standard Name

GST58 (Glutathione S-transferase omega 4, TtGSTo4, GSTo4)

Aliases

PreTt10532 | 76.m00234 | 3810.m02092

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00572020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03411.17.996964956232603e-130glutathione S-transferase doma
in-containing protein (256 aa)
OxytrichaContig19947.0.g220.00000000009998509410508463Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017900.0000000006000548789370351locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
DictyBaseDDB_G02781550.0000000400154582995175mai on chromosome: 3 position
376116 to 376878

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00572020(coding)
ATGTCATAACCCCACCTTAAATTATACGGAAATATACTTTGTCCTTATGTACAAAGAGTG
AGATTTGCTTTGGAAGCCTTGAAACTTTAATACGATTATGTAGAAATAGATTTGTTAGCT
AAAAAGCATTTATAAGAAGAATATCTTGCTATTAATCCCTTGGGATGTGTCCCAACAATT
AACATTAATAACTCAAATGTTTATGAAAGTCTTGTCTTGCTAGAGTTCCTCGAAGAGTAA
TTTGGAAATGTTTTCCCAAAAGATACTATAAAAAGAGCTCAGCAGAGAATATGGGCAAAC
TATTATGATTAAAATGTGATTGGAAATATTTGGGATGTATTCTAAGTCTACAAGAGCAAG
GACGAAGAGGGCTTAAAAAAGTTGGCCAATAAACTTGCAGAAGAAATCAGGTACTGGGTT
AAGCAAACTAAATTATCAGAAAGAGTAAAGGCTAACCCTAAAACTTTCTATGAAGGTGAA
TAACTTACCTATGTTGACTTTGCTGTCGTTCCTCATACAAGATACTTAGAAGATATTGTT
CGTGTCACATTCAACAAATAATTATTTGATTTGGTTGAAAATGATGATCTAATTAAAGAT
TTTAGAACCTACATTAACAACGTAACCTCTTCTGAAGCTTATAATAGAATAACCCATAAG
CTTCCATCATTACCAGCCCACGGAGAAAACTCCCTCCTTGATAGCCTTAACTTTACTCCC
GAAACTTATGACTACAGTAAACTCGTAAGAGCTTATCTTTCCAAAAGATTTGAATCCTGA


>TTHERM_00572020(protein)
MSQPHLKLYGNILCPYVQRVRFALEALKLQYDYVEIDLLAKKHLQEEYLAINPLGCVPTI
NINNSNVYESLVLLEFLEEQFGNVFPKDTIKRAQQRIWANYYDQNVIGNIWDVFQVYKSK
DEEGLKKLANKLAEEIRYWVKQTKLSERVKANPKTFYEGEQLTYVDFAVVPHTRYLEDIV
RVTFNKQLFDLVENDDLIKDFRTYINNVTSSEAYNRITHKLPSLPAHGENSLLDSLNFTP
ETYDYSKLVRAYLSKRFES


>TTHERM_00572020(gene)
ATGTCATAACCCCACCTTAAATTATACGGAAATATACTTTGTCCTTATGTACAAAGAGTG
AGATTTGCTTTGGAAGCCTTGAAACTTTAATACGATTATGTAGAAATAGATTTGTTAGCT
AAAAAGCATTTATAAGAAGAATATCTTGCTATTAATCCCTTGGGATGTGTCCCAACAATT
AACATTAATAACTCAGTAAAATAAATTAATAAATGTTTTAATTTTTCTAATTTTTTATTT
AAAAACAGAATGTTTATGAAAGTCTTGTCTTGCTAGAGTTCCTCGAAGAGTAATTTGGAA
ATGTTTTCCCAAAAGATACTATAAAAAGAGCTCAGCAGAGAATATGGGCAAACTATTATG
ATTAAAATGTGATTGGAAATATTTGGGATGTATTCTAAGTCTACAAGAGCAAGGACGAAG
AGGGCTTAAAAAAGTTGGCCAATAAACTTGCAGAAGAAATCAGGTACTGGGTTAAGCAAA
CTAAATTATCAGAAAGAGTAAAGGCTAACCCTAAAACTTTCTATGAAGGTGAATAACTTA
CCTATGTTGACTTTGCTGTCGTTCCTCATACAAGATACTTAGAAGATATTGTTCGTGTCA
CATTCAACAAATAATTATTTGATTTGGTTGAAAATGATGATCTAATTAAAGATTTTAGAA
CCTACATTAACAACGTAACCTCTTCTGAAGCTTATAATAGAATAACCCATAAGCTTCCAT
CATTACCAGCCCACGGAGAAAACTCCCTCCTTGATAGCCTTAACTTTACTCCCGAAACTT
ATGACTACAGTAAACTCGTAAGAGCTTATCTTTCCAAAAGATTTGAATCCTGA