Identifiers and Description

Gene Model Identifier

TTHERM_00572020

Standard Name

GST58 (Glutathione S-transferase omega 4, TtGSTo4, GSTo4)

Aliases

PreTt10532 | 76.m00234 | 3810.m02092

Description

GST58 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.2%

TetraMine Data

TTHERM_00572020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03411.17.996964956232603e-130glutathione S-transferase doma
in-containing protein (256 aa)
OxytrichaContig19947.0.g220.00000000009998509410508463Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017900.0000000006000548789370351locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
DictyBaseDDB_G02781550.0000000400154582995175mai on chromosome: 3 position
376116 to 376878

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00572020(coding)
ATGTCATAACCCCACCTTAAATTATACGGAAATATACTTTGTCCTTATGTACAAAGAGTG
AGATTTGCTTTGGAAGCCTTGAAACTTTAATACGATTATGTAGAAATAGATTTGTTAGCT
AAAAAGCATTTATAAGAAGAATATCTTGCTATTAATCCCTTGGGATGTGTCCCAACAATT
AACATTAATAACTCAAATGTTTATGAAAGTCTTGTCTTGCTAGAGTTCCTCGAAGAGTAA
TTTGGAAATGTTTTCCCAAAAGATACTATAAAAAGAGCTCAGCAGAGAATATGGGCAAAC
TATTATGATTAAAATGTGATTGGAAATATTTGGGATGTATTCTAAGTCTACAAGAGCAAG
GACGAAGAGGGCTTAAAAAAGTTGGCCAATAAACTTGCAGAAGAAATCAGGTACTGGGTT
AAGCAAACTAAATTATCAGAAAGAGTAAAGGCTAACCCTAAAACTTTCTATGAAGGTGAA
TAACTTACCTATGTTGACTTTGCTGTCGTTCCTCATACAAGATACTTAGAAGATATTGTT
CGTGTCACATTCAACAAATAATTATTTGATTTGGTTGAAAATGATGATCTAATTAAAGAT
TTTAGAACCTACATTAACAACGTAACCTCTTCTGAAGCTTATAATAGAATAACCCATAAG
CTTCCATCATTACCAGCCCACGGAGAAAACTCCCTCCTTGATAGCCTTAACTTTACTCCC
GAAACTTATGACTACAGTAAACTCGTAAGAGCTTATCTTTCCAAAAGATTTGAATCCTGA


>TTHERM_00572020(protein)
MSQPHLKLYGNILCPYVQRVRFALEALKLQYDYVEIDLLAKKHLQEEYLAINPLGCVPTI
NINNSNVYESLVLLEFLEEQFGNVFPKDTIKRAQQRIWANYYDQNVIGNIWDVFQVYKSK
DEEGLKKLANKLAEEIRYWVKQTKLSERVKANPKTFYEGEQLTYVDFAVVPHTRYLEDIV
RVTFNKQLFDLVENDDLIKDFRTYINNVTSSEAYNRITHKLPSLPAHGENSLLDSLNFTP
ETYDYSKLVRAYLSKRFES


>TTHERM_00572020(gene)
ATGTCATAACCCCACCTTAAATTATACGGAAATATACTTTGTCCTTATGTACAAAGAGTG
AGATTTGCTTTGGAAGCCTTGAAACTTTAATACGATTATGTAGAAATAGATTTGTTAGCT
AAAAAGCATTTATAAGAAGAATATCTTGCTATTAATCCCTTGGGATGTGTCCCAACAATT
AACATTAATAACTCAGTAAAATAAATTAATAAATGTTTTAATTTTTCTAATTTTTTATTT
AAAAACAGAATGTTTATGAAAGTCTTGTCTTGCTAGAGTTCCTCGAAGAGTAATTTGGAA
ATGTTTTCCCAAAAGATACTATAAAAAGAGCTCAGCAGAGAATATGGGCAAACTATTATG
ATTAAAATGTGATTGGAAATATTTGGGATGTATTCTAAGTCTACAAGAGCAAGGACGAAG
AGGGCTTAAAAAAGTTGGCCAATAAACTTGCAGAAGAAATCAGGTACTGGGTTAAGCAAA
CTAAATTATCAGAAAGAGTAAAGGCTAACCCTAAAACTTTCTATGAAGGTGAATAACTTA
CCTATGTTGACTTTGCTGTCGTTCCTCATACAAGATACTTAGAAGATATTGTTCGTGTCA
CATTCAACAAATAATTATTTGATTTGGTTGAAAATGATGATCTAATTAAAGATTTTAGAA
CCTACATTAACAACGTAACCTCTTCTGAAGCTTATAATAGAATAACCCATAAGCTTCCAT
CATTACCAGCCCACGGAGAAAACTCCCTCCTTGATAGCCTTAACTTTACTCCCGAAACTT
ATGACTACAGTAAACTCGTAAGAGCTTATCTTTCCAAAAGATTTGAATCCTGA