Identifiers and Description

Gene Model Identifier

TTHERM_00572010

Standard Name

GST57 (Glutathione S-transferase omega 3, TtGSTo3, GSTo3)

Aliases

PreTt10531 | 76.m00233 | 3810.m02091

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00572010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03412.15.999326315775399e-131glutathione S-transferase doma
in-containing protein (260 aa)
WormBaseWBGene000017900.00000000000009996062864481225locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
OxytrichaContig19947.0.g220.0000000006999585478469937Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02781550.0000000029989608248573072mai on chromosome: 3 position
376116 to 376878

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00572010(coding)
ATGTCTTAATTAACATTATATGGCTTTCTCCTCTGCCCTTATGTATAAAGAGTGAGATTC
GCTTTAGAAAAAATTGGAGTTAAGTATGACTACAAAGAAATTGACCTCTTCAAGCTTAAA
TAGAAAGAATAGGCCTACTTAGATATTAACCCTTTTGGAAAGGTTCCTACAATAGTTATT
AATAACCAGATTGTATATGAAAGTCTTCCTCTTCTTGAATTCCTTGAAAATGAATTTGGC
AGCGTCTTCCCTTAAGATAACATCAGAAAAACTTAATAGAGAATTTGGACAACTTATTTT
GATTAAAATTTTATTAGTAAAATGTGGGGAATCTTTAGTCTTATAAAAACAAAGGATGTT
GAAGGATCTAAAAAACTTGCTAACGAACTAGCTGAAATATTGAGATTCTTTACTTTAAAT
TCAAAATTATCTGAAAGAATTAAATAGAATCCTAGCAGCTATTTTGAAGGAGATACTTTA
ACTTATGCTGATTTTGCTATTATCCCTCATGTTAAAGTACTAGAAACTAACTATAAAATA
TTCTTTAAAAGCAGTTTATTTGAATAAATTGAAAACTAGGATGAGTTAATCTAGAATTTC
AAAACCTATTATTAAAATGTTGTTTCTTCTGATTCATTCAAAAGGGCTGTAACTAATCCT
GTTACACTACCTCCATAAGGAGACAATTTCGTTTTAGATGAGTTATAATACACAACTGAA
AACTTTAATTATGAAAACCTTTCAGAAACTTACATGAATAAAAAATTCGCATAAGCTTGA


>TTHERM_00572010(protein)
MSQLTLYGFLLCPYVQRVRFALEKIGVKYDYKEIDLFKLKQKEQAYLDINPFGKVPTIVI
NNQIVYESLPLLEFLENEFGSVFPQDNIRKTQQRIWTTYFDQNFISKMWGIFSLIKTKDV
EGSKKLANELAEILRFFTLNSKLSERIKQNPSSYFEGDTLTYADFAIIPHVKVLETNYKI
FFKSSLFEQIENQDELIQNFKTYYQNVVSSDSFKRAVTNPVTLPPQGDNFVLDELQYTTE
NFNYENLSETYMNKKFAQA


>TTHERM_00572010(gene)
ATAATAAATATTAATAAAAAATAAACAAAACTCTATAAAAATTACAAATAAACAAATAAA
GCAATGTCTTAATTAACATTATATGGCTTTCTCCTCTGCCCTTATGTATAAAGAGTGAGA
TTCGCTTTAGAAAAAATTGGAGTTAAGTATGACTACAAAGAAATTGACCTCTTCAAGCTT
AAATAGAAAGAATAGGCCTACTTAGATATTAACCCTTTTGGAAAGGTTCCTACAATAGTT
ATTAATAACCAGGTATTTATTTATAAATTTACAGTCTTTAAATCTTCTAACTTAACATTT
ATTATATTAATTAGATTGTATATGAAAGTCTTCCTCTTCTTGAATTCCTTGAAAATGAAT
TTGGCAGCGTCTTCCCTTAAGATAACATCAGAAAAACTTAATAGAGAATTTGGACAACTT
ATTTTGATTAAAATTTTATTAGTAAAATGTGGGGAATCTTTAGTCTTATAAAAACAAAGG
ATGTTGAAGGATCTAAAAAACTTGCTAACGAACTAGCTGAAATATTGAGATTCTTTACTT
TAAATTCAAAATTATCTGAAAGAATTAAATAGAATCCTAGCAGCTATTTTGAAGGAGATA
CTTTAACTTATGCTGATTTTGCTATTATCCCTCATGTTAAAGTACTAGAAACTAACTATA
AAATATTCTTTAAAAGCAGTTTATTTGAATAAATTGAAAACTAGGATGAGTTAATCTAGA
ATTTCAAAACCTATTATTAAAATGTTGTTTCTTCTGATTCATTCAAAAGGGCTGTAACTA
ATCCTGTTACACTACCTCCATAAGGAGACAATTTCGTTTTAGATGAGTTATAATACACAA
CTGAAAACTTTAATTATGAAAACCTTTCAGAAACTTACATGAATAAAAAATTCGCATAAG
CTTGA