Identifiers and Description

Gene Model Identifier

TTHERM_00400730

Standard Name

GST56 (Glutathione S-transferase omega 2, TtGSTo2, GSTo2)

Aliases

PreTt12717 | 43.m00235 | 3713.m00063

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00462 ) Glutaredoxin
  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( TIGR00862 ) intracellular chloride channel protein
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 26.5%

TetraMine Data

TTHERM_00400730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03412.13.9983904923729585e-128glutathione S-transferase doma
in-containing protein (260 aa)
WormBaseWBGene000017900.0000000029989608248573072locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
OxytrichaContig19947.0.g220.00000005001214305021125Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02781550.0000004998288985444982mai on chromosome: 3 position
376116 to 376878

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00400730(coding)
ATGTCTTAATTAACATTATACGGTTTTCTCCTCTGCCCTTATGTATAAAGAGCGAGATTT
GCTTTAGAAAACATTGGAGTTAAGTATGACTACAAAGAAATTGATATATATAAATTTAAA
CATAGAGAGTAGGCATATTTAGATATCAATCCTTTTGGAAAGGTTCCTTCAATATCTTTC
AACAACTAGATTATTTATGAAAGTCTCCCCCTTCTTGAATTCCTAGAAAATGAATTTGGT
GGTGTCTTCCCTTAAGATAACATTAGAAAAACATAATAGAGAATATGGGCAAATTACTTT
AATTCAAATTTTATTGATAGAATGTGGGCTATCTTTGGAATTATAAAAAAAAAGGATGCT
GAAGGATCTAAGAAGCTTGCTAACGAATTAGCTGAAGTTCTGAGATTCTTTACAAAAAAT
TCCAAGCTATCTGAAAGAATTAAATTAAACCCAAATAGCTATTTCGAAGGAGAAACATTA
ACTTATGTTGATTTTGCTATTGGTCCTCATTTCAAAATGCTTGATGCTATGTATAGAGTA
TTCTTTAAAGTCAACTTCTTTGATTAAATTGAAAATTAGGATGAACTAATCTAGAATTTC
AAAATTTACTTTCAAAATGTTGTTTCATCCGACTCTTTCAAAAGGACTGTAACTAATCCT
CTTAATCTTCCTGCCTAAGGAGATAACTTCCTTTTAGATCAATTATAATACACTCCTAAA
AGCTATCATTTTGATAATTTTATAGAATTTTATATTACTAAAAGATACGTAGAAGCTTGA


>TTHERM_00400730(protein)
MSQLTLYGFLLCPYVQRARFALENIGVKYDYKEIDIYKFKHREQAYLDINPFGKVPSISF
NNQIIYESLPLLEFLENEFGGVFPQDNIRKTQQRIWANYFNSNFIDRMWAIFGIIKKKDA
EGSKKLANELAEVLRFFTKNSKLSERIKLNPNSYFEGETLTYVDFAIGPHFKMLDAMYRV
FFKVNFFDQIENQDELIQNFKIYFQNVVSSDSFKRTVTNPLNLPAQGDNFLLDQLQYTPK
SYHFDNFIEFYITKRYVEA


>TTHERM_00400730(gene)
ATGTCTTAATTAACATTATACGGTTTTCTCCTCTGCCCTTATGTATAAAGAGCGAGATTT
GCTTTAGAAAACATTGGAGTTAAGTATGACTACAAAGAAATTGATATATATAAATTTAAA
CATAGAGAGTAGGCATATTTAGATATCAATCCTTTTGGAAAGGTTCCTTCAATATCTTTC
AACAACTAGGTATTTATAAATTCTTGAACAATTAATCAATCTAACTAAATATATACTCAA
ATAATTAGATTATTTATGAAAGTCTCCCCCTTCTTGAATTCCTAGAAAATGAATTTGGTG
GTGTCTTCCCTTAAGATAACATTAGAAAAACATAATAGAGAATATGGGCAAATTACTTTA
ATTCAAATTTTATTGATAGAATGTGGGCTATCTTTGGAATTATAAAAAAAAAGGATGCTG
AAGGATCTAAGAAGCTTGCTAACGAATTAGCTGAAGTTCTGAGATTCTTTACAAAAAATT
CCAAGCTATCTGAAAGAATTAAATTAAACCCAAATAGCTATTTCGAAGGAGAAACATTAA
CTTATGTTGATTTTGCTATTGGTCCTCATTTCAAAATGCTTGATGCTATGTATAGAGTAT
TCTTTAAAGTCAACTTCTTTGATTAAATTGAAAATTAGGATGAACTAATCTAGAATTTCA
AAATTTACTTTCAAAATGTTGTTTCATCCGACTCTTTCAAAAGGACTGTAACTAATCCTC
TTAATCTTCCTGCCTAAGGAGATAACTTCCTTTTAGATCAATTATAATACACTCCTAAAA
GCTATCATTTTGATAATTTTATAGAATTTTATATTACTAAAAGATACGTAGAAGCTTGA