Identifiers and Description

Gene Model Identifier

TTHERM_00572000

Standard Name

GST55 (Glutathione S-transferase omega 1, TtGSTo1, GSTo1)

Aliases

PreTt10530 | 76.m00232 | 3810.m02090

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 27.2%

TetraMine Data

TTHERM_00572000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03412.13.9980924833248586e-133glutathione S-transferase doma
in-containing protein (260 aa)
WormBaseWBGene000017900.00000000009001903211590313locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
DictyBaseDDB_G02781550.000000009996807949091551mai on chromosome: 3 position
376116 to 376878
OxytrichaContig19947.0.g220.000000100009565553302Glutathione S-transferase, N-t
erminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00572000(coding)
ATGTCTTAATTAACATTATACGGTTTTCTCCTCTGCCCTTATGTTTAAAGAGTGAGATTT
GCTTTAGAAAACATTGGAGTTAAGTATGACTACAAAGAAGTTGATCTGTATAAATTTAAA
CATAAAGAGTAGGCATATTTAGATATCAATCCTTTTGGAAAGGTTCCTTCAATATCTTTC
AACAACTAGATTATCTATGAAAGTCTCCCTCTTCTTGAATTCTTAGAAAATGAATTTGGT
GGTGTTTTCCCTTAAGATAACATTAGAAAGACATAATAGAGAATATGGGCAAATTACTTT
GATTAAAATTTTATTGATAAAATGTGGGCTATACTTGGAATTATAAAAAAAAAGGATGCT
GAAGGATCTAAGAAGCTTGCTAACGAATTAGCTGAAGCTGTGAGATTCTTTACAAAAAAT
TCAAAGCTATCTGAAAGAATTAAATTAAACCCAAACAACTATTTCGAAGGAGACACATTA
ACTTATGTTGATTTTGCTGTTGTTCCTCATTTCAAAATGCTTGATGCTATGTATAGAGCA
TTCTTTAAAGTCAATTTCTTTGATTAAATTGAAAATTAGGATGAACTAATATAGAATTTC
AAAACTTACTATCAAAATGTTATTTCATCCGACTCTTTCAAAAGGACTGTAACTAATCCT
CTTAATCTTCCTGCCTAAGGAGATAACTTCCTTTTAGATCAATTATAATACACTCCTGAA
AGCTATCATTTTGATAATTTTATAGAAATTTATATTACTAAAAAATTTGTAGAAGCTTGA


>TTHERM_00572000(protein)
MSQLTLYGFLLCPYVQRVRFALENIGVKYDYKEVDLYKFKHKEQAYLDINPFGKVPSISF
NNQIIYESLPLLEFLENEFGGVFPQDNIRKTQQRIWANYFDQNFIDKMWAILGIIKKKDA
EGSKKLANELAEAVRFFTKNSKLSERIKLNPNNYFEGDTLTYVDFAVVPHFKMLDAMYRA
FFKVNFFDQIENQDELIQNFKTYYQNVISSDSFKRTVTNPLNLPAQGDNFLLDQLQYTPE
SYHFDNFIEIYITKKFVEA


>TTHERM_00572000(gene)
ATGTCTTAATTAACATTATACGGTTTTCTCCTCTGCCCTTATGTTTAAAGAGTGAGATTT
GCTTTAGAAAACATTGGAGTTAAGTATGACTACAAAGAAGTTGATCTGTATAAATTTAAA
CATAAAGAGTAGGCATATTTAGATATCAATCCTTTTGGAAAGGTTCCTTCAATATCTTTC
AACAACTAGGTATTTATAATTTCTTGAACAATTAATCAAACTAACTAAATATATATTCAA
TTAACTAATTAGATTATCTATGAAAGTCTCCCTCTTCTTGAATTCTTAGAAAATGAATTT
GGTGGTGTTTTCCCTTAAGATAACATTAGAAAGACATAATAGAGAATATGGGCAAATTAC
TTTGATTAAAATTTTATTGATAAAATGTGGGCTATACTTGGAATTATAAAAAAAAAGGAT
GCTGAAGGATCTAAGAAGCTTGCTAACGAATTAGCTGAAGCTGTGAGATTCTTTACAAAA
AATTCAAAGCTATCTGAAAGAATTAAATTAAACCCAAACAACTATTTCGAAGGAGACACA
TTAACTTATGTTGATTTTGCTGTTGTTCCTCATTTCAAAATGCTTGATGCTATGTATAGA
GCATTCTTTAAAGTCAATTTCTTTGATTAAATTGAAAATTAGGATGAACTAATATAGAAT
TTCAAAACTTACTATCAAAATGTTATTTCATCCGACTCTTTCAAAAGGACTGTAACTAAT
CCTCTTAATCTTCCTGCCTAAGGAGATAACTTCCTTTTAGATCAATTATAATACACTCCT
GAAAGCTATCATTTTGATAATTTTATAGAAATTTATATTACTAAAAAATTTGTAGAAGCT
TGA