Identifiers and Description

Gene Model Identifier

TTHERM_00260690

Standard Name

GST54 (Glutathione S-transferase theta 5, TtGSTt5, GSTt5)

Aliases

PreTt29332 | 23.m00228

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00260690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06480.19.000930187591042e-139glutathione S-transferase doma
in-containing protein (223 aa)
OxytrichaContig4798.0.g171.999981404597394e-31Glutathione S-transferase, C-t
erminal domain
DictyBaseDDB_G02877934.001033848388204e-30DDB_G0287793 on chromosome: 5
position 710171 to 710938
Stentor CoeruleusSteCoe_331686.305116760146989e-16
WormBaseWBGene000017790.0000004998288985444982locus:gst-31 status:Partiall
y_confirmed UniProt:Q9NAA9
protein_id:CAB61109.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00260690(coding)
ATGAACAAACTCAAATTATTTTACAACTCTTTTTCTCAACCTTCTCGCGCTGTAAAATGT
CTTTTAAAGATTGGCAAAGTTGACTATGAAGAGAAATTTGTAAACTTGGCTAAAGGCGAC
TAATTTAAACCTGAAGTAAAGAGCTTAAATTGGAACTGTTAAGTACCTTTTATTGAGGAT
AATGGATTCGTAGTTTTTGAATCCCATACAATAATGAGGTACATACATCAAAGATTTAAC
CTAGACAATTCTTTATACCCTCAAAAGCTAGAAGATAAAACAAAAATTGATATGTACTTA
GACTGGCATCACTCAAATACAAGAAGATCTGCAAATTATGTGACCGCAAGTCTTTTATCA
AAAAGAACTGGTTAACCATCATTATATGTAGAAGATTTAGTTCATAAAGAACTCCTAAAG
GCAGTGCAAAATTTAAATGATAATTTATTAAATAATCCTTCACATTATATCTTTGGATTC
TAAAAGCCAACTATCGCTGATATCAGCTGCTACTAAGAACTTACTGAACTCAAATTGATA
AATTTTGATTTCAAAAAATACCCTAATCTTGATGCTTTTATGAATCAGATGTCTAATATT
CCTGAAATCAAAGAAGTTGATAAAGATTTTTCTGATATCGCTTTAAAGATATTCAAAGTA
AATCTTTGA


>TTHERM_00260690(protein)
MNKLKLFYNSFSQPSRAVKCLLKIGKVDYEEKFVNLAKGDQFKPEVKSLNWNCQVPFIED
NGFVVFESHTIMRYIHQRFNLDNSLYPQKLEDKTKIDMYLDWHHSNTRRSANYVTASLLS
KRTGQPSLYVEDLVHKELLKAVQNLNDNLLNNPSHYIFGFQKPTIADISCYQELTELKLI
NFDFKKYPNLDAFMNQMSNIPEIKEVDKDFSDIALKIFKVNL


>TTHERM_00260690(gene)
ATGAACAAACTCAAATTATTTTACAACTCTTTTTCTCAACCTTCTCGCGCTGTAAAATGT
CTTTTAAAGATTGGCAAAGTTGACTATGAAGAGAAATTTGTAAACTTGGCTAAAGGCGAC
TAATTTAAACCTGAAGTAAAGAGCTTAAATTGGAACTGTTAAGTACCTTTTATTGAGGAT
AATGGATTCGTAGTTTTTGAATCCCATACAATAATGAGGTACATACATCAAAGATTTAAC
CTAGACAATTCTTTATACCCTCAAAAGCTAGAAGATAAAACAAAAATTGATATGTACTTA
GACTGGCATCACTCAAATACAAGAAGATCTGCAAATTATGTGACCGCAAGTCTTTTATCA
AAAAGAACTGGTTAACCATCATTATATGTAGAAGATTTAGTTCATAAAGAACTCCTAAAG
GCAGTGCAAAATTTAAATGATAATTTATTAAATAATCCTTCACATTATATCTTTGGATTC
TAAAAGCCAACTATCGCTGATATCAGCTGCTACTAAGAACTTACTGAACTCAAATTGATA
AATTTTGATTTCAAAAAATACCCTAATCTTGATGCTTTTATGAATCAGATGTCTAATATT
CCTGAAATCAAAGAAGTTGATAAAGATTTTTCTGATATCGCTTTAAAGATATTCAAAGTA
AATCTTTGA