Identifiers and Description

Gene Model Identifier

TTHERM_00499550

Standard Name

GST53 (Glutathione S-transferase theta 4, TtGSTt4, GSTt4)

Aliases

PreTt07998 | 63.m00176 | 3716.m00030

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.1%

TetraMine Data

TTHERM_00499550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09679.12.9990203769197855e-115glutathione S-transferase doma
in-containing protein (233 aa)
OxytrichaContig3600.0.g613.000619078166531e-39Glutathione S-transferase, C-t
erminal domain
DictyBaseDDB_G02877932.00017271388466e-38DDB_G0287793 on chromosome: 5
position 710171 to 710938
Stentor CoeruleusSteCoe_303801.5628821893349888e-18
SGDYNL229C0.0000020007268868677913URE2 Nitrogen catabolite repre
ssion transcriptional regulato
r that acts by inhibition of G
LN3 transcription in good nitr
ogen source; has glutathione p
eroxidase activity and can mut
ate to acquire GST activity; a
ltered form creates [URE3] pri
on
WormBaseWBGene000017530.000004000864880866421locus:gst-5 Probable glutath
ione S-transferase 5 status:
Confirmed UniProt:Q09596 p
rotein_id:CAA86859.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00499550(coding)
ATGAAAATCTTTATTGATTGGATTAGCTAGCCATCTCGAGCAGTAGTTACTTACTGCTTA
ATTGAAAATATACCACATGAGATTATACAAGTTAGAGTAAATGCTTTAGAGCATCGCAAA
CCAGAGTATATTTAAATAAATCCAAGCGCAAAAGTTCCAGCTATTTCAGATAGATTAGAA
AATGGAGAAATATTTAACTTATTTGAAAGCCATGCTATCATGAGATATTTAGCAGATAGA
TATAATAAGTTTAAGCTTTATCCCAAAGATAATATTTAGCTAAGAGCTCTAATAAATAGT
TATTTAGACTGGCACCATAATAACACAAGAAAGTGTGGAGCTTATTTATTTGACTTATAT
TCATCAGGTGTACTAGGAATAAAACCAAAGAATAACATTGAAACGCTATATAAAGAAATT
GAAATTATTTTAAAATTCATTGATTAAATTTGGCTTCAAGAAGGAAAAAATAAGTTTATT
GGAAATAATATTTAGCTTACAATAGCTGACATATCTTGCTATTGCGAAGTATCTCAAATG
ATAATAGATTCTTATGATTTTAAAAATAAAACACCTAATTTATACAACTGGATGAAAAGA
ATTGAATAAATACCAGAAATTTAGTAAACCCATTAAATTTTATTCAAACTAGCTCCAAAA
ATGTCATAAAACAAAATAAAACCTAATCTTTGA


>TTHERM_00499550(protein)
MKIFIDWISQPSRAVVTYCLIENIPHEIIQVRVNALEHRKPEYIQINPSAKVPAISDRLE
NGEIFNLFESHAIMRYLADRYNKFKLYPKDNIQLRALINSYLDWHHNNTRKCGAYLFDLY
SSGVLGIKPKNNIETLYKEIEIILKFIDQIWLQEGKNKFIGNNIQLTIADISCYCEVSQM
IIDSYDFKNKTPNLYNWMKRIEQIPEIQQTHQILFKLAPKMSQNKIKPNL


>TTHERM_00499550(gene)
ATGAAAATCTTTATTGATTGGATTAGCTAGCCATCTCGAGCAGTAGTTACTTACTGCTTA
ATTGAAAATATACCACATGAGATTATACAAGTTAGAGTAAATGCTTTAGAGCATCGCAAA
CCAGAGTATATTTAAATAAATCCAAGCGCAAAAGTTCCAGCTATTTCAGATAGATTAGAA
AATGGAGAAATATTTAACTTATTTGAAAGCCATGCTATCATGAGATATTTAGCAGATAGA
TATAATAAGTTTAAGCTTTATCCCAAAGATAATATTTAGCTAAGAGCTCTAATAAATAGT
TATTTAGACTGGCACCATAATAACACAAGAAAGTGTGGAGCTTATTTATTTGACTTATAT
TCATCAGGTGTACTAGGAATAAAACCAAAGAATAACATTGAAACGCTATATAAAGAAATT
GAAATTATTTTAAAATTCATTGATTAAATTTGGCTTCAAGAAGGAAAAAATAAGTTTATT
GGAAATAATATTTAGCTTACAATAGCTGACATATCTTGCTATTGCGAAGTATCTCAAATG
ATAATAGATTCTTATGATTTTAAAAATAAAACACCTAATTTATACAACTGGATGAAAAGA
ATTGAATAAATACCAGAAATTTAGTAAACCCATTAAATTTTATTCAAACTAGCTCCAAAA
ATGTCATAAAACAAAATAAAACCTAATCTTTGA