Identifiers and Description

Gene Model Identifier

TTHERM_00729240

Standard Name

GST52 (Glutathione S-transferase theta 3, TtGSTt3, GSTt3)

Aliases

PreTt07325 | 118.m00153 | 3739.m00075

Description

Glutathione S-transferase, C-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00729240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17986.16.001368665888701e-135glutathione S-transferase doma
in-containing protein (234 aa)
DictyBaseDDB_G02877936.999359373303508e-39DDB_G0287793 on chromosome: 5
position 710171 to 710938
OxytrichaContig3600.0.g613.0001084582952455e-37Glutathione S-transferase, C-t
erminal domain
Stentor CoeruleusSteCoe_357392.3195228302435696e-16
WormBaseWBGene000017900.0000020007268868677913locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00729240(coding)
ATGAGTATTAAAAACTTATCTTAGCTAAATTATGAAATATTTATGGATTGGGGTAGCTAA
CCTTCAAGGGCTGTCATGACTGTTGTATATTTTCTCAAAATACCTCATAAAATTAACGAA
GTCAGAATTTTAAAAAAGTAGAATGTTAGTGAATAATATAAAAAAATAAATCCTGATCAA
AAAATTCCTTGCATCATTGATAACGAAAACTTTTTTTTGAATGAATCTCATTCAATTATG
AGATATTTCTGCTAACTATATGGTGATAATTAGCTTTACCCTGATGATAATTTAAAAAAG
AGAGCCTTAATTGATAGCTATCTAGACTGGCATCACTCAAACACTCGCAAGATGCATAGA
ATGCTCTTTAAAAAGCTTTTTGAACCACAACTTGGCATTTAAACTTCTATTAATATTGAA
GAATTAGAATCAGATGTGTAAAAAGCTCTAGCTTTTATTGAAAATAACTATTTGAACCAT
AAAAATAAATTCTTCTTTGGATTTGATAACTATACTTTAGCTGATATCAGCGCATATTGT
GAACTTTATTAATCAAAAGTAGTTAATTACAGCTTTTAACCATACCCTAACATTTTAGAA
TGGATGTCAAAAATGTAACAAATAAATGAAATAAAATAAACTCATAAAGTGTATGATGAA
CTGTTAAATAAAAGAATCTAAAAGTAATCATCGAAATTGTGA


>TTHERM_00729240(protein)
MSIKNLSQLNYEIFMDWGSQPSRAVMTVVYFLKIPHKINEVRILKKQNVSEQYKKINPDQ
KIPCIIDNENFFLNESHSIMRYFCQLYGDNQLYPDDNLKKRALIDSYLDWHHSNTRKMHR
MLFKKLFEPQLGIQTSINIEELESDVQKALAFIENNYLNHKNKFFFGFDNYTLADISAYC
ELYQSKVVNYSFQPYPNILEWMSKMQQINEIKQTHKVYDELLNKRIQKQSSKL


>TTHERM_00729240(gene)
ATGAGTATTAAAAACTTATCTTAGCTAAATTATGAAATATTTATGGATTGGGGTAGCTAA
CCTTCAAGGGCTGTCATGACTGTTGTATATTTTCTCAAAATACCTCATAAAATTAACGAA
GTCAGAATTTTAAAAAAGTAGAATGTTAGTGAATAATATAAAAAAATAAATCCTGATCAA
AAAATTCCTTGCATCATTGATAACGAAAACTTTTTTTTGAATGAATCTCATTCAATTATG
AGATATTTCTGCTAACTATATGGTGATAATTAGCTTTACCCTGATGATAATTTAAAAAAG
AGAGCCTTAATTGATAGCTATCTAGACTGGCATCACTCAAACACTCGCAAGATGCATAGA
ATGCTCTTTAAAAAGCTTTTTGAACCACAACTTGGCATTTAAACTTCTATTAATATTGAA
GAATTAGAATCAGATGTGTAAAAAGCTCTAGCTTTTATTGAAAATAACTATTTGAACCAT
AAAAATAAATTCTTCTTTGGATTTGATAACTATACTTTAGCTGATATCAGCGCATATTGT
GAACTTTATTAATCAAAAGTAGTTAATTACAGCTTTTAACCATACCCTAACATTTTAGAA
TGGATGTCAAAAATGTAACAAATAAATGAAATAAAATAAACTCATAAAGTGTATGATGAA
CTGTTAAATAAAAGAATCTAAAAGTAATCATCGAAATTGTGA