Identifiers and Description

Gene Model Identifier

TTHERM_00499540

Standard Name

GST50 (Glutathione S-transferase theta 1, TtGSTt1, GSTt1)

Aliases

PreTt07997 | 63.m00175 | 3716.m00029

Description

Glutathione S-transferase, C-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.6%

TetraMine Data

TTHERM_00499540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09679.13.999155465305724e-142glutathione S-transferase doma
in-containing protein (233 aa)
DictyBaseDDB_G02877938.003017249547689e-39DDB_G0287793 on chromosome: 5
position 710171 to 710938
OxytrichaContig10677.0.g591.0002335610448659e-38Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_106611.5628821893349888e-18
WormBaseWBGene000017850.0007003012208360162locus:gst-37 status:Partiall
y_confirmed UniProt:Q9BPM4
protein_id:CCD74297.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00499540(coding)
ATGACAACAAAACCAAGCACTAAACTTTATATTGAATGGCTTAGTTAGCCATCTAGAGCT
ATTGTAACTTTTTGCTTAATTGAAAATATTCCTCATGAGTTGGTAGAAGTTAGAATTAAA
AAGTTAGAAAACAGAACTCCAGAATATAAAAAAATGTTCCCCACTGCTAAGTTGCCTGGA
ATGTCTGAAACTCTTGAAAACGGCGAATAATTTAATTTATTTGAAAGCCATGCAATCATG
AGATACTTAGCAGACAGATATAACAAATCTAATCTTTATCCAAGAGGAAATATTTAGCTA
AAGGCTAAAGTTGATTCTTACTTAGATTGGCATCATACAAATACAAGAAAATGCGCTCCT
TATCTTTTTGATCAATACTTCGCTCCTGTTTTAGGTATTAAGCCTTAATTTGATGTGAAC
ACATTATTTAAAGAAGTTGAAAGTGTTTTCAGGTTTATTGAGAGGGTTTGGTTAGATCAA
GGAAAGAATAAATATATAGGTAATAACTAACAGTTAACAATAGCTGACTTATCATGCTAT
TCTGAGATTATTTAAATGAAATTTGATGATTATGATTTCAAAAACAAGACTCCTATTTTA
TATGAATGGATGTAGAGAATAGAAGCTCTTCCAGAAATATAAAAAACTCATCAAGTTTTA
TTTAAGTTAGCTCCTTAAATTTCTAAGAACAAATAAAAAGCAAAATTATGA


>TTHERM_00499540(protein)
MTTKPSTKLYIEWLSQPSRAIVTFCLIENIPHELVEVRIKKLENRTPEYKKMFPTAKLPG
MSETLENGEQFNLFESHAIMRYLADRYNKSNLYPRGNIQLKAKVDSYLDWHHTNTRKCAP
YLFDQYFAPVLGIKPQFDVNTLFKEVESVFRFIERVWLDQGKNKYIGNNQQLTIADLSCY
SEIIQMKFDDYDFKNKTPILYEWMQRIEALPEIQKTHQVLFKLAPQISKNKQKAKL


>TTHERM_00499540(gene)
ATGACAACAAAACCAAGCACTAAACTTTATATTGAATGGCTTAGTTAGCCATCTAGAGCT
ATTGTAACTTTTTGCTTAATTGAAAATATTCCTCATGAGTTGGTAGAAGTTAGAATTAAA
AAGTTAGAAAACAGAACTCCAGAATATAAAAAAATGTTCCCCACTGCTAAGTTGCCTGGA
ATGTCTGAAACTCTTGAAAACGGCGAATAATTTAATTTATTTGAAAGCCATGCAATCATG
AGATACTTAGCAGACAGATATAACAAATCTAATCTTTATCCAAGAGGAAATATTTAGCTA
AAGGCTAAAGTTGATTCTTACTTAGATTGGCATCATACAAATACAAGAAAATGCGCTCCT
TATCTTTTTGATCAATACTTCGCTCCTGTTTTAGGTATTAAGCCTTAATTTGATGTGAAC
ACATTATTTAAAGAAGTTGAAAGTGTTTTCAGGTTTATTGAGAGGGTTTGGTTAGATCAA
GGAAAGAATAAATATATAGGTAATAACTAACAGTTAACAATAGCTGACTTATCATGCTAT
TCTGAGATTATTTAAATGAAATTTGATGATTATGATTTCAAAAACAAGACTCCTATTTTA
TATGAATGGATGTAGAGAATAGAAGCTCTTCCAGAAATATAAAAAACTCATCAAGTTTTA
TTTAAGTTAGCTCCTTAAATTTCTAAGAACAAATAAAAAGCAAAATTATGA