Identifiers and Description

Gene Model Identifier

TTHERM_00895750

Standard Name

GST5 (Glutathione S-transferase mu 5, TtGSTm5, GSTm5)

Aliases

PreTt21957 | 159.m00065

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.6%

TetraMine Data

TTHERM_00895750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04320.12.9992439173235726e-110glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig686.1.g631.000361553249356e-16Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000211270.000019995566179747357status:Confirmed UniProt:O45
010 protein_id:CCD73396.1
DictyBaseDDB_G02740810.0007003012208360162DDB_G0274081 on chromosome: 2
position 3748941 to 3749724

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00895750(coding)
ATGGGCTGTTAAAATTCAACTGGTTAAGTAAATGATATTCAAGCAAAAAACAGTGCTAAC
TTAGTTTTAGGTTATTGGGGACTTCCATTAAGAGGTCAACCTCTCAGATATATCTTAGAG
CTTGCTAACTATCCTTACACAGAAACTAAATACACTTTATCTCAAGCTACTGATTGGTTT
GGTAAAGATAAATAAGAACTAGAATTAGATTTCCCAAATCTTCCATATCTCATTCATGGT
GATTTCTCAATTACAGAGTCTTCTAATATTGCAAACTATTTGATCCAGTTAACAAAATAA
TATTATCTTCAAGGAGAAGGCTAAGATAAATACAGAGTTGATAACATTAGATATGTATGC
GATGAACTGGCAGCTAAAATATTTTCATCAACTCTCTAGAAGGAAGAAGAAAAGAAGAAT
TAATTAGACACTTAAATTCTTCCTAAAATTAAATAGCTCTAAAAGGTATTAGGAACTTAG
ACTTCATTCTTCAAGAAATTGACTTTAGCAGACATTTATGCTTACACAGCATTGGCCTAT
TTCAAAAAGACATACTCTAAGGAATATCAGCAATTCTCATCAGACTTCGATCCTTTTTTA
AAGAGATTTGAAGAAATTCCTAGAATAAAAAATTATCATCAATCTTAAAGATATAAAAAG
TTATGA


>TTHERM_00895750(protein)
MGCQNSTGQVNDIQAKNSANLVLGYWGLPLRGQPLRYILELANYPYTETKYTLSQATDWF
GKDKQELELDFPNLPYLIHGDFSITESSNIANYLIQLTKQYYLQGEGQDKYRVDNIRYVC
DELAAKIFSSTLQKEEEKKNQLDTQILPKIKQLQKVLGTQTSFFKKLTLADIYAYTALAY
FKKTYSKEYQQFSSDFDPFLKRFEEIPRIKNYHQSQRYKKL


>TTHERM_00895750(gene)
ATGGGCTGTTAAAATTCAACTGGTTAAGTAAATGATATTCAAGCAAAAAACAGTGCTAAC
TTAGTTTTAGGTTATTGGGGACTTCCATTAAGAGGTCAACCTCTCAGATATATCTTAGAG
CTTGCTAACTATCCTTACACAGAAACTAAATACACTTTATCTCAAGCTACTGATTGGTTT
GGTAAAGATAAATAAGAACTAGAATTAGATTTCCCAAATCTTCCATATCTCATTCATGGT
GATTTCTCAATTACAGAGTCTTCTAATATTGCAAACTATTTGATCCAGTTAACAAAATAA
TATTATCTTCAAGGAGAAGGCTAAGATAAATACAGAGTTGATAACATTAGATATGTATGC
GATGAACTGGCAGCTAAAATATTTTCATCAACTCTCTAGAAGGAAGAAGAAAAGAAGAAT
TAATTAGACACTTAAATTCTTCCTAAAATTAAATAGCTCTAAAAGGTATTAGGAACTTAG
ACTTCATTCTTCAAGAAATTGACTTTAGCAGACATTTATGCTTACACAGCATTGGCCTAT
TTCAAAAAGACATACTCTAAGGAATATCAGCAATTCTCATCAGACTTCGATCCTTTTTTA
AAGAGATTTGAAGAAATTCCTAGAATAAAAAATTATCATCAATCTTAAAGATATAAAAAG
TTATGA