Identifiers and Description

Gene Model Identifier

TTHERM_00473230

Standard Name

GST48 (Glutathione S-transferase mu 48, TtGSTm48, GSTm48)

Aliases

PreTt02223 | 57.m00162 | 3709.m00023

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00473230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13105.11.9992560499818233e-109hypothetical protein (226 aa)
OxytrichaContig16299.0.g152.000769134519826e-18Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017710.000000009996807949091551locus:gst-23 status:Partiall
y_confirmed UniProt:P91505
protein_id:CCD70568.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00473230(coding)
ATGCAGTAACAACAGTAGAGTAAAATAAAATTAGGGTATTGGGACGTTAGAGGAAGAGGT
GAGCCTATTAGATTACTTCTAAATTACTTAAAGCTAGAATATGAAGATGAAATATACCCT
TTGAGTGATAGGGAAAAATGGTTCAATTTCAAAAGAAACTCCTAAGAATTATTTATAAAT
CTGCCATATGTTTAGATTGAAAGTAAGGAGACATAAAGTTAATCAATTTATGTTGAGAGC
GATAGTATTAGCATTTTTATTTGTTAAAATTTTGGAGGAGAGCAATTACTAGGCAAAGAT
TTAGTTTTACTTAGTAAAATGAGAGGAGTAACTGAAGATGTTAAGCTTTATTTAAGCAGA
TATGCTTATCACAATGATTTTGCTGAAGCAGATCAGCTCTTCCTCTAAAAAAGACTTTAA
CCAATTCTCTTAAGGTTAAACACTTATCTTTAAAATTATAAATATTTATTAGGAAGCAAC
ATTTCTTATCTAGATTTTGTTCTTTATGAGTCATTGAAGACATTAGAAAAAATAAAAAAG
GAGTATTTACAATCTCATACATATCTAGTATAATACATAAAAAATATTGAAAATATTCCT
TAGATTAAAGCCTATCTTTCTTCTGAAAGATTTCACAAAGATTTTTTATTTTATGGAGAT
CCTTCTCCTATTTGA


>TTHERM_00473230(protein)
MQQQQQSKIKLGYWDVRGRGEPIRLLLNYLKLEYEDEIYPLSDREKWFNFKRNSQELFIN
LPYVQIESKETQSQSIYVESDSISIFICQNFGGEQLLGKDLVLLSKMRGVTEDVKLYLSR
YAYHNDFAEADQLFLQKRLQPILLRLNTYLQNYKYLLGSNISYLDFVLYESLKTLEKIKK
EYLQSHTYLVQYIKNIENIPQIKAYLSSERFHKDFLFYGDPSPI


>TTHERM_00473230(gene)
ATGCAGTAACAACAGTAGAGTAAAATAAAATTAGGGTATTGGGACGTTAGAGGAAGAGGT
GAGCCTATTAGATTACTTCTAAATTACTTAAAGCTAGAATATGAAGATGAAATATACCCT
TTGAGTGATAGGGAAAAATGGTTCAATTTCAAAAGAAACTCCTAAGAATTATTTATAAAT
CTGCCATATGTTTAGATTGAAAGTAAGGAGACATAAAGTTAATCAATTTATGTTGAGAGC
GATAGTATTAGCATTTTTATTTGTTAAAATTTTGGAGGAGAGCAATTACTAGGCAAAGAT
TTAGTTTTACTTAGTAAAATGAGAGGAGTAACTGAAGATGTTAAGCTTTATTTAAGCAGA
TATGCTTATCACAATGATTTTGCTGAAGCAGATCAGCTCTTCCTCTAAAAAAGACTTTAA
CCAATTCTCTTAAGGTTAAACACTTATCTTTAAAATTATAAATATTTATTAGGAAGCAAC
ATTTCTTATCTAGATTTTGTTCTTTATGAGTCATTGAAGACATTAGAAAAAATAAAAAAG
GAGTATTTACAATCTCATACATATCTAGTATAATACATAAAAAATATTGAAAATATTCCT
TAGATTAAAGCCTATCTTTCTTCTGAAAGATTTCACAAAGATTTTTTATTTTATGGAGAT
CCTTCTCCTATTTGA