Identifiers and Description

Gene Model Identifier

TTHERM_00077560

Standard Name

GST47 (Glutathione S-transferase mu 47, TtGSTm47, GSTm47)

Aliases

PreTt10102 | 5.m00453 | 3828.m01362

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 25.6%

TetraMine Data

TTHERM_00077560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07080.11.9998944264638884e-101glutathione S-transferase doma
in-containing protein (236 aa)
OxytrichaContig16299.0.g153.9992896861436003e-19Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_298040.0000003059023205018258
DictyBaseDDB_G02681380.00020003864201578029DDB_G0268138 on chromosome: 1
position 1528262 to 1528973

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00077560(coding)
ATGAAATCATAACTTTTATTTGGGTCCTGGATTTAAAGAGGAAATGCTATGCCTATAAGA
TTTCTTTTAGAATATACCTAAACCAATTATAATGAAAAAATATATTATTCAGAAAATGAG
AGTGAGTGGTTTTAAAAAGATTAAAAATAATTCAAACAATTTGCAAATTTGCCCTACATT
ATAGATGGAGATTTAAAATTAACAGATGTACAAACTATTATGAGATATATAGCAAAACGT
AATTCTAATTATATCTAATTGCTTGGTTAAGGACATGGAAACGATGAAGACAGAATTAAC
TAGATTAATCTTGTAATATCTGAAATAGGACTTTATGTTAAAGAACAATTTTTTAATCCA
AAGGTTCATGAAGAAAAAAGAGATTTTCTAAACAGATGCTAAAAAAAATTTGGAAGTTTT
GTTAACATAAGAGGTAAAAATAAATTTATTTTTCCTTATGTAACCACAGCTGATTTTAAT
TTAGTTGAGCTTCTTTTGCATTATAAATGTTTAGACAATGAACTTTTTGAAAAAAATCTT
CCCAGTTTAAATGAATATATATAGCATTTTTACAATTTACCGGCAATTAAAGATTACACA
ATAACAGAAAGATATTAGATGCATACTGAATTCTTTCCATAGAATAAAGCTATTATTTCG
GGAAAAGATTTTATAACTAAATTTAATTCTTAATTTAAAAAATGA


>TTHERM_00077560(protein)
MKSQLLFGSWIQRGNAMPIRFLLEYTQTNYNEKIYYSENESEWFQKDQKQFKQFANLPYI
IDGDLKLTDVQTIMRYIAKRNSNYIQLLGQGHGNDEDRINQINLVISEIGLYVKEQFFNP
KVHEEKRDFLNRCQKKFGSFVNIRGKNKFIFPYVTTADFNLVELLLHYKCLDNELFEKNL
PSLNEYIQHFYNLPAIKDYTITERYQMHTEFFPQNKAIISGKDFITKFNSQFKK


>TTHERM_00077560(gene)
ATGAAATCATAACTTTTATTTGGGTCCTGGATTTAAAGAGGAAATGCTATGCCTATAAGA
TTTCTTTTAGAATATACCTAAACCAATTATAATGAAAAAATATATTATTCAGAAAATGAG
AGTGAGTGGTTTTAAAAAGATTAAAAATAATTCAAACAATTTGCAAATTTGCCCTACATT
ATAGATGGAGATTTAAAATTAACAGATGTACAAACTATTATGAGATATATAGCAAAACGT
AATTCTAATTATATCTAATTGCTTGGTTAAGGACATGGAAACGATGAAGACAGAATTAAC
TAGATTAATCTTGTAATATCTGAAATAGGACTTTATGTTAAAGAACAATTTTTTAATCCA
AAGGTTCATGAAGAAAAAAGAGATTTTCTAAACAGATGCTAAAAAAAATTTGGAAGTTTT
GTTAACATAAGAGGTAAAAATAAATTTATTTTTCCTTATGTAACCACAGCTGATTTTAAT
TTAGTTGAGCTTCTTTTGCATTATAAATGTTTAGACAATGAACTTTTTGAAAAAAATCTT
CCCAGTTTAAATGAATATATATAGCATTTTTACAATTTACCGGCAATTAAAGATTACACA
ATAACAGAAAGATATTAGATGCATACTGAATTCTTTCCATAGAATAAAGCTATTATTTCG
GGAAAAGATTTTATAACTAAATTTAATTCTTAATTTAAAAAATGA