Identifiers and Description

Gene Model Identifier

TTHERM_00661538

Standard Name

GST43 (Glutathione S-transferase mu 43, TtGSTm43, GSTm43)

Aliases

3736.m00677

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.8%

TetraMine Data

TTHERM_00661538

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17228.19.998707956568768e-117hypothetical protein (222 aa)
OxytrichaContig16299.0.g151.000137892321693e-31Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_298040.0000000000006914400106940203
DictyBaseDDB_G02740810.000000004999139696582238DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017490.0000000400154582995175locus:gst-1 Glutathione S-tr
ansferase P status:Confirmed
UniProt:P10299 protein_id
:CAA78471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00661538(protein)
MSEDKLILGYWPFRGVAQTIRYLLEYLEVPYEQKSYMTYEEWFGKDKKELGADFPNLPYI
KQGDFILTESYAIIIYLCKKYNRLDLLGADKNDLIRETKVHQVASAIKDTGKTIGDLCFN
PKFHSVKDEVYTQKLSQMLKKTTDFLGDKQFLLGELTITDFMFYEQLQYFKNIFPESITP
QLQQFIERIENIPKIKEFLNSDRIFKKQFLPPTFATWSGIE


>TTHERM_00661538(coding)
ATGTCTGAAGATAAGTTGATATTAGGTTATTGGCCATTTAGGGGTGTTGCTTAAACAATT
AGATACCTTCTTGAATACTTGGAAGTTCCATACGAACAAAAAAGTTATATGACTTATGAA
GAGTGGTTTGGAAAAGACAAAAAAGAATTAGGTGCTGATTTTCCTAATTTGCCCTACATT
AAATAAGGAGATTTTATTTTAACAGAATCTTACGCAATAATTATATATCTATGTAAGAAA
TATAATAGATTAGATTTGTTAGGTGCAGATAAAAATGACTTAATTAGAGAGACTAAAGTT
CATTAAGTAGCATCAGCCATCAAAGACACTGGAAAAACTATTGGTGATTTGTGTTTTAAT
CCTAAGTTCCATAGCGTTAAAGATGAGGTTTACACTCAAAAACTTTCATAAATGTTAAAA
AAAACCACTGATTTTTTGGGTGATAAACAATTTTTGTTAGGAGAATTAACTATCACTGAT
TTTATGTTTTATGAGTAGCTATAATACTTCAAAAATATCTTCCCTGAAAGTATAACTCCT
TAGTTATAGTAATTCATTGAAAGAATAGAAAACATTCCTAAAATTAAAGAATTTTTAAAT
TCAGATAGAATTTTCAAAAAATAATTTCTTCCTCCTACCTTTGCAACTTGGTCAGGTATT
GAGTGA


>TTHERM_00661538(gene)
ATGTCTGAAGATAAGTTGATATTAGGTTATTGGCCATTTAGGGGTGTTGCTTAAACAATT
AGATACCTTCTTGAATACTTGGAAGTTCCATACGAACAAAAAAGTTATATGACTTATGAA
GAGTGGTTTGGAAAAGACAAAAAAGAATTAGGTGCTGATTTTCCTAATTTGCCCTACATT
AAATAAGGAGATTTTATTTTAACAGAATCTTACGCAATAATTATATATCTATGTAAGAAA
TATAATAGATTAGATTTGTTAGGTGCAGATAAAAATGACTTAATTAGAGAGACTAAAGTT
CATTAAGTAGCATCAGCCATCAAAGACACTGGAAAAACTATTGGTGATTTGTGTTTTAAT
CCTAAGTTCCATAGCGTTAAAGATGAGGTTTACACTCAAAAACTTTCATAAATGTTAAAA
GTAAAAATATTTATAATATTTATAAGTTAATTAACTGAATTTTAAAATAGAAAACCACTG
ATTTTTTGGGTGATAAACAATTTTTGTTAGGAGAATTAACTATCACTGATTTTATGTTTT
ATGAGTAGCTATAATACTTCAAAAATATCTTCCCTGAAAGTATAACTCCTTAGTTATAGT
AATTCATTGAAAGAATAGAAAACATTCCTAAAATTAAAGAATTTTTAAATTCAGATAGAA
TTTTCAAAAAATAATTTCTTCCTCCTACCTTTGCAACTTGGTCAGGTATTGAGTGA