Identifiers and Description

Gene Model Identifier

TTHERM_00463010

Standard Name

GST42 (Glutathione S-transferase mu 42, TtGSTm42, GSTm42)

Aliases

PreTt25753 | 54.m00209 | 3823.m01122

Description

GST42 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.9%

TetraMine Data

TTHERM_00463010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10743.11.0002534232488231e-144glutathione S-transferase doma
in-containing protein (228 aa)
OxytrichaContig3021.0.g276.002718307283067e-26Glutathione S-transferase, C-t
erminal domain
DictyBaseDDB_G02681380.00000000000020009182674645818DDB_G0268138 on chromosome: 1
position 1528262 to 1528973
WormBaseWBGene000017530.00000000009998509410508463locus:gst-5 Probable glutath
ione S-transferase 5 status:
Confirmed UniProt:Q09596 p
rotein_id:CAA86859.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463010(coding)
ATGTTGGTTGTAATAATTTATATTTATTTTTATTTTATTAAGTTCAATAAAATTTAGAAA
GCAAAGATAAACAAATAAATAATTATATAAATAGGAATATAGATAAACTTATAGATGGCT
GAAAAAAATTAGATTACATTAGGGTATTGGAATATAAGAGGTTTAGGTTAGCTAAGCAGA
TATCTTCTTGAATACACTGGTCTTAAGTACAAGGAAAAGAGATATTAAAAGCTTGAGGAA
TGGTTCTAAAAGGATAAGTAAGGATTAGGAATAGAATTTGCAAACTTACCTTATTTAATA
GATGGAGATTTAAAATTAACCGAAAGCCACGCAGTAAATCTGTACATTATAAGAAAGAGC
GGCAAGAATGAATTGCTAGGAACTAATCTGATCGAGGAATCTAAAATTAGAGAGCTTATT
GGATATTTAGAAGATTTTTTCAGATAAATATTAACTTTGTGCTTTAATCCTTAATTTAGT
ATCATTAAGTAACAAAAGTATAATGATGACTTTAGCCTAAGATTGCAAAGATTGGAAAAT
CAGCTCACTAAAGACAACAGAAAATGGCTTAATGGTCAATCACTTAGCCTTCCTGATTTT
ATATTCTATGAAATTAGTTAATACATTAAAGGAATCTATCCCGAAGAATTTAAAAAACTG
CCAAAAATCTAAGCCTTCCAAGCCCGTTTTGAAGAAATTGAGTAAATATAAGACTATATG
ATGTCTGAAGAGTACATTTATGCTCCATTCTTAGCAGTTGGTCATGGAGCCTAATGGACT
GGCTTAAAATAAAAATGA


>TTHERM_00463010(protein)
MLVVIIYIYFYFIKFNKIQKAKINKQIIIQIGIQINLQMAEKNQITLGYWNIRGLGQLSR
YLLEYTGLKYKEKRYQKLEEWFQKDKQGLGIEFANLPYLIDGDLKLTESHAVNLYIIRKS
GKNELLGTNLIEESKIRELIGYLEDFFRQILTLCFNPQFSIIKQQKYNDDFSLRLQRLEN
QLTKDNRKWLNGQSLSLPDFIFYEISQYIKGIYPEEFKKLPKIQAFQARFEEIEQIQDYM
MSEEYIYAPFLAVGHGAQWTGLKQK


>TTHERM_00463010(gene)
ATGTTGGTTGTAATAATTTATATTTATTTTTATTTTATTAAGTTCAATAAAATTTAGAAA
GCAAAGATAAACAAATAAATAATTATATAAATAGGAATATAGATAAACTTATAGATGGCT
GAAAAAAATTAGATTACATTAGGGTATTGGAATATAAGAGGTTTAGGTTAGCTAAGCAGA
TATCTTCTTGAATACACTGGTCTTAAGTACAAGGAAAAGAGATATTAAAAGCTTGAGGAA
TGGTTCTAAAAGGATAAGTAAGGATTAGGAATAGAATTTGCAAACTTACCTTATTTAATA
GATGGAGATTTAAAATTAACCGAAAGCCACGCAGTAAATCTGTACATTATAAGAAAGAGC
GGCAAGAATGAATTGCTAGGAACTAATCTGATCGAGGAATCTAAAATTAGAGAGCTTATT
GGATATTTAGAAGATTTTTTCAGATAAATATTAACTTTGTGCTTTAATCCTTAATTTAGT
ATCATTAAGTAACAAAAGTATAATGATGACTTTAGCCTAAGATTGCAAAGATTGGAAAAT
CAGCTCACTAAAGACAACAGAAAATGGCTTAATGGTCAATCACTTAGCCTTCCTGATTTT
ATATTCTATGAAATTAGTTAATACATTAAAGGAATCTATCCCGAAGAATTTAAAAAACTG
CCAAAAATCTAAGCCTTCCAAGCCCGTTTTGAAGAAATTGAGTAAATATAAGACTATATG
ATGTCTGAAGAGTACATTTATGCTCCATTCTTAGCAGTTGGTCATGGAGCCTAATGGACT
GGCTTAAAATAAAAATGA