Identifiers and Description

Gene Model Identifier

TTHERM_00463010

Standard Name

GST42 (Glutathione S-transferase mu 42, TtGSTm42, GSTm42)

Aliases

PreTt25753 | 54.m00209 | 3823.m01122

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00463010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10743.11.0002534232488231e-144glutathione S-transferase doma
in-containing protein (228 aa)
OxytrichaContig3021.0.g276.002718307283067e-26Glutathione S-transferase, C-t
erminal domain
DictyBaseDDB_G02681380.00000000000020009182674645818DDB_G0268138 on chromosome: 1
position 1528262 to 1528973
WormBaseWBGene000017530.00000000009998509410508463locus:gst-5 Probable glutath
ione S-transferase 5 status:
Confirmed UniProt:Q09596 p
rotein_id:CAA86859.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463010(coding)
ATGTTGGTTGTAATAATTTATATTTATTTTTATTTTATTAAGTTCAATAAAATTTAGAAA
GCAAAGATAAACAAATAAATAATTATATAAATAGGAATATAGATAAACTTATAGATGGCT
GAAAAAAATTAGATTACATTAGGGTATTGGAATATAAGAGGTTTAGGTTAGCTAAGCAGA
TATCTTCTTGAATACACTGGTCTTAAGTACAAGGAAAAGAGATATTAAAAGCTTGAGGAA
TGGTTCTAAAAGGATAAGTAAGGATTAGGAATAGAATTTGCAAACTTACCTTATTTAATA
GATGGAGATTTAAAATTAACCGAAAGCCACGCAGTAAATCTGTACATTATAAGAAAGAGC
GGCAAGAATGAATTGCTAGGAACTAATCTGATCGAGGAATCTAAAATTAGAGAGCTTATT
GGATATTTAGAAGATTTTTTCAGATAAATATTAACTTTGTGCTTTAATCCTTAATTTAGT
ATCATTAAGTAACAAAAGTATAATGATGACTTTAGCCTAAGATTGCAAAGATTGGAAAAT
CAGCTCACTAAAGACAACAGAAAATGGCTTAATGGTCAATCACTTAGCCTTCCTGATTTT
ATATTCTATGAAATTAGTTAATACATTAAAGGAATCTATCCCGAAGAATTTAAAAAACTG
CCAAAAATCTAAGCCTTCCAAGCCCGTTTTGAAGAAATTGAGTAAATATAAGACTATATG
ATGTCTGAAGAGTACATTTATGCTCCATTCTTAGCAGTTGGTCATGGAGCCTAATGGACT
GGCTTAAAATAAAAATGA


>TTHERM_00463010(protein)
MLVVIIYIYFYFIKFNKIQKAKINKQIIIQIGIQINLQMAEKNQITLGYWNIRGLGQLSR
YLLEYTGLKYKEKRYQKLEEWFQKDKQGLGIEFANLPYLIDGDLKLTESHAVNLYIIRKS
GKNELLGTNLIEESKIRELIGYLEDFFRQILTLCFNPQFSIIKQQKYNDDFSLRLQRLEN
QLTKDNRKWLNGQSLSLPDFIFYEISQYIKGIYPEEFKKLPKIQAFQARFEEIEQIQDYM
MSEEYIYAPFLAVGHGAQWTGLKQK


>TTHERM_00463010(gene)
TTGATAAAATATAATTTAATTAAAAAAAACCTGATGTTGGTTGTAATAATTTATATTTAT
TTTTATTTTATTAAGTTCAATAAAATTTAGAAAGCAAAGATAAACAAATAAATAATTATA
TAAATAGGAATATAGATAAACTTATAGATGGCTGAAAAAAATTAGATTACATTAGGGTAT
TGGAATATAAGAGGTTTAGGTTAGCTAAGCAGATATCTTCTTGAATACACTGGTCTTAAG
TACAAGGAAAAGAGATATTAAAAGCTTGAGGAATGGTTCTAAAAGGATAAGTAAGGATTA
GGAATAGAATTTGCAAACTTACCTTATTTAATAGATGGAGATTTAAAATTAACCGAAAGC
CACGCAGTAAATCTGTACATTATAAGAAAGAGCGGCAAGAATGAATTGCTAGGAACTAAT
CTGATCGAGGAATCTAAAATTAGAGAGCTTATTGGATATTTAGAAGATTTTTTCAGATAA
ATATTAACTTTGTGCTTTAATCCTTAATTTAGTATCATTAAGTAACAAAAGTATAATGAT
GACTTTAGCCTAAGATTGCAAAGATTGGAAAATCAGCTCACTAAAGACAACAGAAAATGG
CTTAATGGTCAATCACTTAGCCTTCCTGATTTTATATTCTATGAAATTAGTTAATACATT
AAAGGAATCTATCCCGAAGAATTTAAAAAACTGCCAAAAATCTAAGCCTTCCAAGCCCGT
TTTGAAGAAATTGAGTAAATATAAGACTATATGATGTCTGAAGAGTACATTTATGCTCCA
TTCTTAGCAGTTGGTCATGGAGCCTAATGGACTGGCTTAAAATAAAAATGATTAAATGAA
AATATATTTAAATATAAATGGTTTTTAATTATTTAAATCGATATTTTGCATTTAAATTTC
AAAGAATTCCTGTAATCAGTCAGTTTTTATTTTATGTTAAACAACTCAAATTTGTTTCAG
TTTAGTAAGTAGAAAAAAAAATATAAAGATTTTATTTTGTTTTATTTTTTGAAATATTGT
ATTTTATTTC