Identifiers and Description

Gene Model Identifier

TTHERM_00661630

Standard Name

GST41 (Glutathione S-transferase mu 41, TtGSTm41, GSTm41)

Aliases

PreTt23808 | 98.m00151 | 3736.m00051

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.1%

TetraMine Data

TTHERM_00661630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17214.16.00073507697681e-75glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig16299.0.g158.000124778438792e-23Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_314820.0000000000002543665647376923
DictyBaseDDB_G02803170.000005998506718272351DDB_G0280317 on chromosome: 3
position 3248423 to 3249124

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00661630(coding)
ATGATAACTCTAGGATATTGGGGAGTTAGAGGTTTAGGAGAATCTGTTAGATATTTACTT
GCCTATTTAAATGTAGATTATAAACACTAAGCTTATTATAATCCTTAAGATTGGTTTGCT
AAGGACAAGGCTTAACTTAAAATAGAGTTTTCAAATCTTCCCTATCTAATAGATGGAGAG
TAGAAAATTACTGATTCCTATGCAATATCGATCTACATCATAAGAAAGTATCATAGAGAA
GACTTATTAGGATATTCAGAAGACGGAAGCTACAATGAAAGAGAAGTTAAAATTGCTTAG
CTAATCGGCGTTACAAGAGATATATTTTAATAAATAGTACATATCTGTTTCAGCCCTTAA
TTTGATAAGATAAAGGATTAGGCTTTCGAAAAAGGACAAATATTTCTCAATCAGCTAACT
GATTTTCTTGGTGACAAACAATTTTTACTTGGTCATTTAAGTTTAGCAGATTTTCTGTTT
TATGAAGCACTCACTTATTATTAAGTCCTTCATTCTTAATCTATTACCTAAAGGCATGAA
GAGTATATGCATTAATTTGAAAGTCTTCCTGGTATTAAATAATATTTAAACTATGCTAGC
AAAAACTTTAATTCGTTTTTGTTAAATTTAAAGTAATAGTAACAGTAATAACAATAAAAA
ATTTCTTTATGA


>TTHERM_00661630(protein)
MITLGYWGVRGLGESVRYLLAYLNVDYKHQAYYNPQDWFAKDKAQLKIEFSNLPYLIDGE
QKITDSYAISIYIIRKYHREDLLGYSEDGSYNEREVKIAQLIGVTRDIFQQIVHICFSPQ
FDKIKDQAFEKGQIFLNQLTDFLGDKQFLLGHLSLADFLFYEALTYYQVLHSQSITQRHE
EYMHQFESLPGIKQYLNYASKNFNSFLLNLKQQQQQQQQKISL


>TTHERM_00661630(gene)
ATGATAACTCTAGGATATTGGGGAGTTAGAGGTTTAGGAGAATCTGTTAGATATTTACTT
GCCTATTTAAATGTAGATTATAAACACTAAGCTTATTATAATCCTTAAGATTGGTTTGCT
AAGGACAAGGCTTAACTTAAAATAGAGTTTTCAAATCTTCCCTATCTAATAGATGGAGAG
TAGAAAATTACTGATTCCTATGCAATATCGATCTACATCATAAGAAAGTATCATAGAGAA
GACTTATTAGGATATTCAGAAGACGGAAGCTACAATGAAAGAGAAGTTAAAATTGCTTAG
CTAATCGGCGTTACAAGAGATATATTTTAATAAATAGTACATATCTGTTTCAGCCCTTAA
TTTGATAAGATAAAGGATTAGGCTTTCGAAAAAGGACAAATATTTCTCAATCAGCTAACT
GATTTTCTTGGTGACAAACAATTTTTACTTGGTCATTTAAGTTTAGCAGATTTTCTGTTT
TATGAAGCACTCACTTATTATTAAGTCCTTCATTCTTAATCTATTACCTAAAGGCATGAA
GAGTATATGCATTAATTTGAAAGTCTTCCTGGTATTAAATAATATTTAAACTATGCTAGC
AAAAACTTTAATTCGTTTTTGTTAAATTTAAAGTAATAGTAACAGTAATAACAATAAAAA
ATTTCTTTATGA