Identifiers and Description

Gene Model Identifier

TTHERM_00166100

Standard Name

GST37 (Glutathione S-transferase mu 37, TtGSTm37, GSTm37)

Aliases

PreTt29717 | 14.m00284

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00166100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17214.19.003233894748109e-95glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig16299.0.g151.9993007828132465e-27Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_298046.305116760146989e-16
WormBaseWBGene000017710.0000000010002658722841845locus:gst-23 status:Partiall
y_confirmed UniProt:P91505
protein_id:CCD70568.1
DictyBaseDDB_G02803170.00000019998969434520019DDB_G0280317 on chromosome: 3
position 3248423 to 3249124

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00166100(coding)
ATGATTACTTTCGGCTATTGGAACATTAGAGGCTTTGGCTAACCTATCCGCTTCTTGCTT
GCTTATTTAGGAGTGAAATACACCAATAAAACTTATGCCTCTCTTGAAGAATGGTTTGGA
AATGACAAAGACAATCTTGGTTTAGAATTCCCTAATCTTCCATATTTAATTGATGGAGAT
GTTAAGCTCATTGAGTCTTTCGCTATTCCTGTCTACTTAATTAAGAAGTACAAATAATTC
TAACTTTTAGGATTATAAGCTGATGGATCTAGCACCAATAAAGAAGTAAAAGTCACTCAG
TTAATGGGAGTTATCAGAGATATAGCAAAAGAAATCAATTTAACTTGCTTCAGACCTGAT
TTCTATGAAGTAAAAGAGAAGGTTTATACAGAAAAAGTTGAGTATATGTTTAAAAAACTT
ACAAATTTTTTAGGAAACAAGTTATTTTTGTTGGAGAGATTGACTTATGCAGATTTTCAT
TTCTATGAGTTGGTTAACCGTGTATAATACATATACCCTTAAGCAATGACTGCAGCCCTA
ACTGCTTATTTAAAAAGATTTGAAAACTTGCCTGGCATCAAAGAATATATAGCAAATCCA
AATATTAACCTTAAGGCTCACTTACCTGGTTTTATGGCAACTTGGACTGGCCCTTAATGA


>TTHERM_00166100(protein)
MITFGYWNIRGFGQPIRFLLAYLGVKYTNKTYASLEEWFGNDKDNLGLEFPNLPYLIDGD
VKLIESFAIPVYLIKKYKQFQLLGLQADGSSTNKEVKVTQLMGVIRDIAKEINLTCFRPD
FYEVKEKVYTEKVEYMFKKLTNFLGNKLFLLERLTYADFHFYELVNRVQYIYPQAMTAAL
TAYLKRFENLPGIKEYIANPNINLKAHLPGFMATWTGPQ


>TTHERM_00166100(gene)
ATGATTACTTTCGGCTATTGGAACATTAGAGGCTTTGGCTAACCTATCCGCTTCTTGCTT
GCTTATTTAGGAGTGAAATACACCAATAAAACTTATGCCTCTCTTGAAGAATGGTTTGGA
AATGACAAAGACAATCTTGGTTTAGAATTCCCTAATCTTCCATATTTAATTGATGGAGAT
GTTAAGCTCATTGAGTCTTTCGCTATTCCTGTCTACTTAATTAAGAAGTACAAATAATTC
TAACTTTTAGGATTATAAGCTGATGGATCTAGCACCAATAAAGAAGTAAAAGTCACTCAG
TTAATGGGAGTTATCAGAGATATAGCAAAAGAAATCAATTTAACTTGCTTCAGACCTGAT
TTCTATGAAGTAAAAGAGAAGGTTTATACAGAAAAAGTTGAGTATATGTTTAAAAAACTT
ACAAATTTTTTAGGAAACAAGTTATTTTTGTTGGAGAGATTGACTTATGCAGATTTTCAT
TTCTATGAGTTGGTTAACCGTGTATAATACATATACCCTTAAGCAATGACTGCAGCCCTA
ACTGCTTATTTAAAAAGATTTGAAAACTTGCCTGGCATCAAAGAATATATAGCAAATCCA
AATATTAACCTTAAGGCTCACTTACCTGGTTTTATGGCAACTTGGACTGGCCCTTAATGA