Identifiers and Description

Gene Model Identifier

TTHERM_00169110

Standard Name

GST36 (Glutathione S-transferase mu 36, TtGSTm36, GSTm36)

Aliases

PreTt29721 | 14.m00288

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07699 ) GCC2 and GCC3
  • ( PF05294 ) Scorpion short toxin
  • ( PF07846 ) Metallothionein family 7
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF00641 ) Zn-finger in Ran binding protein
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain
  • ( TIGR01566 ) ZF-HD homeobox protein Cys/His-rich dimerization

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00169110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11759.19.995317835403734e-19hypothetical protein (366 aa)
OxytrichaContig4658.0.g20.000000100009565553302GCC2 and GCC3
WormBaseWBGene000776970.00003998524687536623status:Partially_confirmed U
niProt:H2FLH1 protein_id:CCF
23381.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00169110(coding)
ATGAATTCGTTAAGCTGTGATCTATGTTTACCAAACTTTTATTACAATGAGAAAAATAGT
TAAGTACATGTTGATAGGAATTAAGTACCTGTTTGCATTGAATGCCCACAAGGATCAGGG
ACTAATCAAGCAAATATAGATAATTTTTAAATTTCTAGTTGTAGTATTTGCTTACAAAAT
TATTATATGACAAATCCTTCTTCTTAGTCACCCACTCTAAATTCTGCATAATGTCTACCG
TGCCCTAATGGAACTCTTAGTTCTGGAGCTTAAACAGTTGATCAATCTGTATGCAACTCT
TGTGCAATAAATTATTATATGGCTTAAAGCTCAATAGCTGCTTCATAAAATAATAATAAT
TAAGGAGTGGCTGCTTAATGTTTAGTTTGTCCATAAGGAAGTGGTACTTTAGAAGATTTA
AATATTTAAGGTGATATTTCTCAGTGTTCAATATGCTTAGAGAACTATTTTATGGTATCT
CCTGCAATTTAGTCAGCTTAAGGAATATAACCATCTGCTGCATAATGTATCTCTTGCCCT
AATAATTCTTATAACCCTAAAAATTCTTAATAAGGATATTGTACTTGCTATGATTCAAAT
GCAACTCCTTTATCATCTTAAGTCTAATCATGCAACTGCAAAAATGGCTATTATGGAAGT
GTTGCTACTTCTTAAAATGCTCCATCAGGTTGTTTTCCTTGTCCCTAAGGGTAGTATTCT
AATAGTTAAACACAGCATAACTGCCAAACATGTCCTTCTAAATTTGTGACTAACTTAGAT
TAAAGCGGTTGCGTTTGTAATGTAGCAGGCCTTGGTGTAATTTTGGACTAATCAACAAAT
AATTGTACATGTAAAAATGGTTATCAAGAAGACATTTCAAGTCTTTCTGGCTGCTCTTCT
TGTCCATAAGGTTTTTATTCTAATAGTTCTACTTCTTTTAAATGTATATCTTGCCCTTCT
GGATCTTAAACAAATAATGATTAAAGTAATTGTATTTGTAATGATAATAGCTTAGCAGTA
TATTTTGATCCTATTAGCATATCTTGTAAATGCTAGAAAGATTATTTTGGAAATCCTTCA
TAAGCTACTCTAGCTACTATTGGATCTTGTACTCCATGCCCTACAAAATTTTAAGCTACC
TTCTCTTAAAATGAAATAATGAAATCTTAGTGTGTATTTTCTACATTTTAAAATTTCATT
TCATTTAGCTTAGTGCTAGCTGCTATACAACTATGTATTCTGTTATGA


>TTHERM_00169110(protein)
MNSLSCDLCLPNFYYNEKNSQVHVDRNQVPVCIECPQGSGTNQANIDNFQISSCSICLQN
YYMTNPSSQSPTLNSAQCLPCPNGTLSSGAQTVDQSVCNSCAINYYMAQSSIAASQNNNN
QGVAAQCLVCPQGSGTLEDLNIQGDISQCSICLENYFMVSPAIQSAQGIQPSAAQCISCP
NNSYNPKNSQQGYCTCYDSNATPLSSQVQSCNCKNGYYGSVATSQNAPSGCFPCPQGQYS
NSQTQHNCQTCPSKFVTNLDQSGCVCNVAGLGVILDQSTNNCTCKNGYQEDISSLSGCSS
CPQGFYSNSSTSFKCISCPSGSQTNNDQSNCICNDNSLAVYFDPISISCKCQKDYFGNPS
QATLATIGSCTPCPTKFQATFSQNEIMKSQCVFSTFQNFISFSLVLAAIQLCILL


>TTHERM_00169110(gene)
ATGAATTCGTTAAGCTGTGATCTATGTTTACCAAACTTTTATTACAATGAGAAAAATAGT
TAAGTACATGTTGATAGGAATTAAGTACCTGTTTGCATTGAATGCCCACAAGGATCAGGG
ACTAATCAAGCAAATATAGATAATTTTTAAATTTCTAGTTGTAGTATTTGCTTACAAAAT
TATTATATGACAAATCCTTCTTCTTAGTCACCCACTCTAAATTCTGCATAATGTCTACCG
TGCCCTAATGGAACTCTTAGTTCTGGAGCTTAAACAGTTGATCAATCTGTATGCAACTCT
TGTGCAATAAATTATTATATGGCTTAAAGCTCAATAGCTGCTTCATAAAATAATAATAAT
TAAGGAGTGGCTGCTTAATGTTTAGTTTGTCCATAAGGAAGTGGTACTTTAGAAGATTTA
AATATTTAAGGTGATATTTCTCAGTGTTCAATATGCTTAGAGAACTATTTTATGGTATCT
CCTGCAATTTAGTCAGCTTAAGGAATATAACCATCTGCTGCATAATGTATCTCTTGCCCT
AATAATTCTTATAACCCTAAAAATTCTTAATAAGGATATTGTACTTGCTATGATTCAAAT
GCAACTCCTTTATCATCTTAAGTCTAATCATGCAACTGCAAAAATGGCTATTATGGAAGT
GTTGCTACTTCTTAAAATGCTCCATCAGGTTGTTTTCCTTGTCCCTAAGGGTAGTATTCT
AATAGTTAAACACAGCATAACTGCCAAACATGTCCTTCTAAATTTGTGACTAACTTAGAT
TAAAGCGGTTGCGTTTGTAATGTAGCAGGCCTTGGTGTAATTTTGGACTAATCAACAAAT
AATTGTACATGTAAAAATGGTTATCAAGAAGACATTTCAAGTCTTTCTGGCTGCTCTTCT
TGTCCATAAGGTTTTTATTCTAATAGTTCTACTTCTTTTAAATGTATATCTTGCCCTTCT
GGATCTTAAACAAATAATGATTAAAGTAATTGTATTTGTAATGATAATAGCTTAGCAGTA
TATTTTGATCCTATTAGCATATCTTGTAAATGCTAGAAAGATTATTTTGGAAATCCTTCA
TAAGCTACTCTAGCTACTATTGGATCTTGTACTCCATGCCCTACAAAATTTTAAGCTACC
TTCTCTTAAAATGAAATAATGAAATCTTAGTGTGTATTTTCTACATTTTAAAATTTCATT
TCATTTAGCTTAGTGCTAGCTGCTATACAACTATGTATTCTGTTATGA